Recombinant Human PCLAF Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : PCLAF-2149H
Product Overview : KIAA0101 MS Standard C13 and N15-labeled recombinant protein (NP_055551) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : PCNA-binding protein that acts as a regulator of DNA repair during DNA replication. Following DNA damage, the interaction with PCNA is disrupted, facilitating the interaction between monoubiquitinated PCNA and the translesion DNA synthesis DNA polymerase eta (POLH) at stalled replisomes, facilitating the bypass of replication-fork-blocking lesions. Also acts as a regulator of centrosome number.
Molecular Mass : 12 kDa
AA Sequence : MVRTKADSVPGTYRKVVAARAPRKVLGSSTSATNSTSVSSRKAENKYAGGNPVCVRPTPKWQKGIGEFFRLSPKDSEKENQIPEEAGSSGLGKAKRKACPLQPDHTNDEKETRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name PCLAF PCNA clamp associated factor [ Homo sapiens (human) ]
Official Symbol PCLAF
Synonyms PCLAF; PCNA clamp associated factor; L5; PAF; OEATC; PAF15; OEATC1; p15PAF; NS5ATP9; OEATC-1; p15/PAF; KIAA0101; p15(PAF); PCNA-associated factor; HCV NS5A-transactivated protein 9; PCNA-associated factor of 15 kDa; hepatitis C virus NS5A-transactivated protein 9; overexpressed in anaplastic thyroid carcinoma 1
Gene ID 9768
mRNA Refseq NM_014736
Protein Refseq NP_055551
MIM 610696
UniProt ID Q15004

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PCLAF Products

Required fields are marked with *

My Review for All PCLAF Products

Required fields are marked with *

0
cart-icon
0
compare icon