Recombinant Human PCLAF Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: PCLAF-2149H
• Product Overview: KIAA0101 MS Standard C13 and N15-labeled recombinant protein (NP_055551) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: PCNA-binding protein that acts as a regulator of DNA repair during DNA replication. Following DNA damage, the interaction with PCNA is disrupted, facilitating the interaction between monoubiquitinated PCNA and the translesion DNA synthesis DNA polymerase eta (POLH) at stalled replisomes, facilitating the bypass of replication-fork-blocking lesions. Also acts as a regulator of centrosome number.
• Molecular Mass: 12 kDa
• AA Sequence: MVRTKADSVPGTYRKVVAARAPRKVLGSSTSATNSTSVSSRKAENKYAGGNPVCVRPTPKWQKGIGEFFRLSPKDSEKENQIPEEAGSSGLGKAKRKACPLQPDHTNDEKETRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: PCLAF PCNA clamp associated factor [ Homo sapiens (human) ]
• Official Symbol: PCLAF
• Synonyms: PCLAF; PCNA clamp associated factor; L5; PAF; OEATC; PAF15; OEATC1; p15PAF; NS5ATP9; OEATC-1; p15/PAF; KIAA0101; p15(PAF); PCNA-associated factor; HCV NS5A-transactivated protein 9; PCNA-associated factor of 15 kDa; hepatitis C virus NS5A-transactivated protein 9; overexpressed in anaplastic thyroid carcinoma 1
• Gene ID: 9768
• mRNA Refseq: NM_014736
• Protein Refseq: NP_055551
• MIM: 610696
• UniProt ID: Q15004