Recombinant Human PCSK1 protein(641-730 aa), C-His-tagged

Cat.No. : PCSK1-2711H
Product Overview : Recombinant Human PCSK1 protein(P29120)(641-730 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 641-730 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : LVSKSPSSSSVGGRRDELEEGAPSQAMLRLLQSAFSKNSPPKQSPKKSPSAKLNIPYENFYEALEKLNKPSQLKDSEDSLYNDYVDVFYN
Gene Name PCSK1 proprotein convertase subtilisin/kexin type 1 [ Homo sapiens ]
Official Symbol PCSK1
Synonyms PCSK1; proprotein convertase subtilisin/kexin type 1; NEC1; neuroendocrine convertase 1; PC1; PC3; prohormone convertase 1; prohormone convertase 3; proprotein convertase 1; SPC3; NEC 1; BMIQ12;
Gene ID 5122
mRNA Refseq NM_000439
Protein Refseq NP_000430
MIM 162150
UniProt ID P29120

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PCSK1 Products

Required fields are marked with *

My Review for All PCSK1 Products

Required fields are marked with *

0
cart-icon