Recombinant Human PCSK1 protein(641-730 aa), C-His-tagged
Cat.No. : | PCSK1-2711H |
Product Overview : | Recombinant Human PCSK1 protein(P29120)(641-730 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 641-730 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | LVSKSPSSSSVGGRRDELEEGAPSQAMLRLLQSAFSKNSPPKQSPKKSPSAKLNIPYENFYEALEKLNKPSQLKDSEDSLYNDYVDVFYN |
Gene Name | PCSK1 proprotein convertase subtilisin/kexin type 1 [ Homo sapiens ] |
Official Symbol | PCSK1 |
Synonyms | PCSK1; proprotein convertase subtilisin/kexin type 1; NEC1; neuroendocrine convertase 1; PC1; PC3; prohormone convertase 1; prohormone convertase 3; proprotein convertase 1; SPC3; NEC 1; BMIQ12; |
Gene ID | 5122 |
mRNA Refseq | NM_000439 |
Protein Refseq | NP_000430 |
MIM | 162150 |
UniProt ID | P29120 |
◆ Recombinant Proteins | ||
PCSK1-6846H | Recombinant Human PCSK1 protein, His-tagged | +Inquiry |
PCSK1-6562M | Recombinant Mouse PCSK1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PCSK1-3808H | Recombinant Human PCSK1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PCSK1-6845H | Recombinant Human PCSK1 protein, His-tagged | +Inquiry |
PCSK1-87H | Active Recombinant Human PCSK1, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PCSK1-2249HCL | Recombinant Human PCSK1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PCSK1 Products
Required fields are marked with *
My Review for All PCSK1 Products
Required fields are marked with *