Recombinant Human PCSK1 protein(641-730 aa), C-His-tagged

• Cat.No.: PCSK1-2711H
• Product Overview: Recombinant Human PCSK1 protein(P29120)(641-730 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 641-730 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: LVSKSPSSSSVGGRRDELEEGAPSQAMLRLLQSAFSKNSPPKQSPKKSPSAKLNIPYENFYEALEKLNKPSQLKDSEDSLYNDYVDVFYN

Gene Information

• Gene Name: PCSK1 proprotein convertase subtilisin/kexin type 1 [ Homo sapiens ]
• Official Symbol: PCSK1
• Synonyms: PCSK1; proprotein convertase subtilisin/kexin type 1; NEC1; neuroendocrine convertase 1; PC1; PC3; prohormone convertase 1; prohormone convertase 3; proprotein convertase 1; SPC3; NEC 1; BMIQ12
• Gene ID: 5122
• mRNA Refseq: NM_000439
• Protein Refseq: NP_000430
• MIM: 162150
• UniProt ID: P29120