Recombinant Human PCSK6 protein, His-tagged

• Cat.No.: PCSK6-6332H
• Product Overview: Recombinant Human PCSK6 protein(P29122)(860-969aa), fused with C-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 860-969aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 19.4 kDa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: REECIHCAKNFHFHDWKCVPACGEGFYPEEMPGLPHKVCRRCDENCLSCAGSSRNCSRCKTGFTQLGTSCITNHTCSNADETFCEMVKSNRLCERKLFIQFCCRTCLLAG

Gene Information

• Gene Name: PCSK6 proprotein convertase subtilisin/kexin type 6 [ Homo sapiens ]
• Official Symbol: PCSK6
• Synonyms: PCSK6; proprotein convertase subtilisin/kexin type 6; PACE4, paired basic amino acid cleaving system 4; SPC4; subtilisin like proprotein convertase 4; subtilisin like protease; subtilisin/kexin like protease PACE4; subtilisin/kexin-like protease PACE4; subtilisin-like proprotein convertase 4; paired basic amino acid cleaving enzyme 4; paired basic amino acid cleaving system 4; PACE4
• Gene ID: 5046
• mRNA Refseq: NM_002570
• Protein Refseq: NP_002561
• MIM: 167405
• UniProt ID: P29122