Recombinant Human PCYT1A

Cat.No. : PCYT1A-29486TH
Product Overview : Recombinant fragment of Human PCYT1A with N terminal proprietary tag; Predicted MW 35.42kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 89 amino acids
Molecular Weight : 35.420kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : DAQCSAKVNARKRRKEAPGPNGATEEDGVPSKVQRCAVGLRQPAPFSDEIEVDFSKPYVRVTMEEASRGTPCERPVRVYADGIFDLFHS
Sequence Similarities : Belongs to the cytidylyltransferase family.
Gene Name PCYT1A phosphate cytidylyltransferase 1, choline, alpha [ Homo sapiens ]
Official Symbol PCYT1A
Synonyms PCYT1A; phosphate cytidylyltransferase 1, choline, alpha; PCYT1, phosphate cytidylyltransferase 1, choline, alpha isoform; choline-phosphate cytidylyltransferase A; CT; CTPCT; phosphate cytidylyltransferase 1; choline; alpha isoform;
Gene ID 5130
mRNA Refseq NM_005017
Protein Refseq NP_005008
MIM 123695
Uniprot ID P49585
Chromosome Location 3q29
Pathway Acetylcholine Synthesis, organism-specific biosystem; Glycerophospholipid metabolism, organism-specific biosystem; Glycerophospholipid metabolism, conserved biosystem; Metabolic pathways, organism-specific biosystem; Phosphatidylcholine (PC) biosynthesis, choline =>
Function choline-phosphate cytidylyltransferase activity; lipid binding; nucleotidyltransferase activity; transferase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PCYT1A Products

Required fields are marked with *

My Review for All PCYT1A Products

Required fields are marked with *

0
cart-icon
0
compare icon