Recombinant Human PCYT1A

• Cat.No.: PCYT1A-29486TH
• Product Overview: Recombinant fragment of Human PCYT1A with N terminal proprietary tag; Predicted MW 35.42kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 89 amino acids
• Molecular Weight: 35.420kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: DAQCSAKVNARKRRKEAPGPNGATEEDGVPSKVQRCAVGLRQPAPFSDEIEVDFSKPYVRVTMEEASRGTPCERPVRVYADGIFDLFHS
• Sequence Similarities: Belongs to the cytidylyltransferase family.

Gene Information

• Gene Name: PCYT1A phosphate cytidylyltransferase 1, choline, alpha [ Homo sapiens ]
• Official Symbol: PCYT1A
• Synonyms: PCYT1A; phosphate cytidylyltransferase 1, choline, alpha; PCYT1, phosphate cytidylyltransferase 1, choline, alpha isoform; choline-phosphate cytidylyltransferase A; CT; CTPCT; phosphate cytidylyltransferase 1; choline; alpha isoform
• Gene ID: 5130
• mRNA Refseq: NM_005017
• Protein Refseq: NP_005008
• MIM: 123695
• Uniprot ID: P49585
• Chromosome Location: 3q29
• Pathway: Acetylcholine Synthesis, organism-specific biosystem; Glycerophospholipid metabolism, organism-specific biosystem; Glycerophospholipid metabolism, conserved biosystem; Metabolic pathways, organism-specific biosystem; Phosphatidylcholine (PC) biosynthesis, choline =>
• Function: choline-phosphate cytidylyltransferase activity; lipid binding; nucleotidyltransferase activity; transferase activity