Recombinant Human PCYT1A
Cat.No. : | PCYT1A-29486TH |
Product Overview : | Recombinant fragment of Human PCYT1A with N terminal proprietary tag; Predicted MW 35.42kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 89 amino acids |
Molecular Weight : | 35.420kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | DAQCSAKVNARKRRKEAPGPNGATEEDGVPSKVQRCAVGLRQPAPFSDEIEVDFSKPYVRVTMEEASRGTPCERPVRVYADGIFDLFHS |
Sequence Similarities : | Belongs to the cytidylyltransferase family. |
Gene Name | PCYT1A phosphate cytidylyltransferase 1, choline, alpha [ Homo sapiens ] |
Official Symbol | PCYT1A |
Synonyms | PCYT1A; phosphate cytidylyltransferase 1, choline, alpha; PCYT1, phosphate cytidylyltransferase 1, choline, alpha isoform; choline-phosphate cytidylyltransferase A; CT; CTPCT; phosphate cytidylyltransferase 1; choline; alpha isoform; |
Gene ID | 5130 |
mRNA Refseq | NM_005017 |
Protein Refseq | NP_005008 |
MIM | 123695 |
Uniprot ID | P49585 |
Chromosome Location | 3q29 |
Pathway | Acetylcholine Synthesis, organism-specific biosystem; Glycerophospholipid metabolism, organism-specific biosystem; Glycerophospholipid metabolism, conserved biosystem; Metabolic pathways, organism-specific biosystem; Phosphatidylcholine (PC) biosynthesis, choline => |
Function | choline-phosphate cytidylyltransferase activity; lipid binding; nucleotidyltransferase activity; transferase activity; |
◆ Recombinant Proteins | ||
PCYT1A-788H | Recombinant Human PCYT1A protein, His-tagged | +Inquiry |
PCYT1A-12525M | Recombinant Mouse PCYT1A Protein | +Inquiry |
PCYT1A-29484TH | Recombinant Human PCYT1A | +Inquiry |
PCYT1A-3974R | Recombinant Rat PCYT1A Protein, His (Fc)-Avi-tagged | +Inquiry |
PCYT1A-549HFL | Recombinant Full Length Human PCYT1A Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PCYT1A-3366HCL | Recombinant Human PCYT1A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PCYT1A Products
Required fields are marked with *
My Review for All PCYT1A Products
Required fields are marked with *