Recombinant Human PCYT1A protein, His-tagged
Cat.No. : | PCYT1A-788H |
Product Overview : | Recombinant Human PCYT1A protein(1-76 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | His |
Protein Length : | 1-76 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | MDAQCSAKVNARKRRKEAPGPNGATEEDGVPSKVQRCAVGLRQPAPFSDEIEVDFSKPYVRVTMEEASRGTPCERP |
Purity : | 85%, by SDS-PAGE. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | PCYT1A phosphate cytidylyltransferase 1, choline, alpha [ Homo sapiens ] |
Official Symbol | PCYT1A |
Synonyms | PCYT1A; phosphate cytidylyltransferase 1, choline, alpha; PCYT1, phosphate cytidylyltransferase 1, choline, alpha isoform; choline-phosphate cytidylyltransferase A; CT; CTPCT; phosphate cytidylyltransferase 1; choline; alpha isoform; CT A; CCT A; CCT-alpha; phosphorylcholine transferase A; CTP:phosphocholine cytidylyltransferase A; CTA; CCTA; PCYT1; |
mRNA Refseq | NM_005017 |
Protein Refseq | NP_005008 |
MIM | 123695 |
UniProt ID | P49585 |
Gene ID | 5130 |
◆ Recombinant Proteins | ||
PCYT1A-3665H | Recombinant Human PCYT1A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PCYT1A-29484TH | Recombinant Human PCYT1A | +Inquiry |
PCYT1A-4314R | Recombinant Rat PCYT1A Protein | +Inquiry |
PCYT1A-364HF | Recombinant Full Length Human PCYT1A Protein | +Inquiry |
PCYT1A-787H | Recombinant Human PCYT1A protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PCYT1A-3366HCL | Recombinant Human PCYT1A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PCYT1A Products
Required fields are marked with *
My Review for All PCYT1A Products
Required fields are marked with *
0
Inquiry Basket