Recombinant Human PDCD11 protein, His&Myc-tagged
Cat.No. : | PDCD11-5344H |
Product Overview : | Recombinant Human PDCD11 protein(Q14690)(1200-1420aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 1200-1420aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 31.6 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | GQALRATVVGPDSSKTLLCLSLTGPHKLEEGEVAMGRVVKVTPNEGLTVSFPFGKIGTVSIFHMSDSYSETPLEDFVPQKVVRCYILSTADNVLTLSLRSSRTNPETKSKVEDPEINSIQDIKEGQLLRGYVGSIQPHGVFFRLGPSVVGLARYSHVSQHSPSKKALYNKHLPEGKLLTARVLRLNHQKNLVELSFLPGDTGKPDVLSASLEGQLTKQEER |
Gene Name | PDCD11 programmed cell death 11 [ Homo sapiens ] |
Official Symbol | PDCD11 |
Synonyms | PDCD11; programmed cell death 11; protein RRP5 homolog; ALG 4; KIAA0185; RRP5; apoptosis-linked gene 4; NF-kappa-B-binding protein; programmed cell death protein 11; ALG4; NFBP; ALG-4; |
Gene ID | 22984 |
mRNA Refseq | NM_014976 |
Protein Refseq | NP_055791 |
MIM | 612333 |
UniProt ID | Q14690 |
◆ Recombinant Proteins | ||
PDCD11-5520Z | Recombinant Zebrafish PDCD11 | +Inquiry |
PDCD11-12531M | Recombinant Mouse PDCD11 Protein | +Inquiry |
PDCD11-2422H | Recombinant Human PDCD11 protein, His-tagged | +Inquiry |
PDCD11-5344H | Recombinant Human PDCD11 protein, His&Myc-tagged | +Inquiry |
PDCD11-6572M | Recombinant Mouse PDCD11 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PDCD11 Products
Required fields are marked with *
My Review for All PDCD11 Products
Required fields are marked with *