Recombinant Human PDCD11 protein, His-tagged
| Cat.No. : | PDCD11-2422H |
| Product Overview : | Recombinant Human PDCD11 protein(Q14690)(1200-1420aa), fused with C-terminal His tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 1200-1420aa |
| Tag : | C-His |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 25.7 kDa |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | GQALRATVVGPDSSKTLLCLSLTGPHKLEEGEVAMGRVVKVTPNEGLTVSFPFGKIGTVSIFHMSDSYSETPLEDFVPQKVVRCYILSTADNVLTLSLRSSRTNPETKSKVEDPEINSIQDIKEGQLLRGYVGSIQPHGVFFRLGPSVVGLARYSHVSQHSPSKKALYNKHLPEGKLLTARVLRLNHQKNLVELSFLPGDTGKPDVLSASLEGQLTKQEER |
| Gene Name | PDCD11 programmed cell death 11 [ Homo sapiens ] |
| Official Symbol | PDCD11 |
| Synonyms | PDCD11; programmed cell death 11; protein RRP5 homolog; ALG 4; KIAA0185; RRP5; apoptosis-linked gene 4; NF-kappa-B-binding protein; programmed cell death protein 11; ALG4; NFBP; ALG-4; |
| Gene ID | 22984 |
| mRNA Refseq | NM_014976 |
| Protein Refseq | NP_055791 |
| MIM | 612333 |
| UniProt ID | Q14690 |
| ◆ Recombinant Proteins | ||
| PDCD11-5520Z | Recombinant Zebrafish PDCD11 | +Inquiry |
| PDCD11-5344H | Recombinant Human PDCD11 protein, His&Myc-tagged | +Inquiry |
| PDCD11-12531M | Recombinant Mouse PDCD11 Protein | +Inquiry |
| PDCD11-6572M | Recombinant Mouse PDCD11 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PDCD11-2422H | Recombinant Human PDCD11 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PDCD11 Products
Required fields are marked with *
My Review for All PDCD11 Products
Required fields are marked with *
