Recombinant Human PDCD6 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : PDCD6-2556H
Product Overview : PDCD6 MS Standard C13 and N15-labeled recombinant protein (NP_037364) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a calcium-binding protein belonging to the penta-EF-hand protein family. Calcium binding is important for homodimerization and for conformational changes required for binding to other protein partners. This gene product participates in T cell receptor-, Fas-, and glucocorticoid-induced programmed cell death. In mice deficient for this gene product, however, apoptosis was not blocked suggesting this gene product is functionally redundant. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is also located on the short arm of chromosome 5.
Molecular Mass : 21.9 kDa
AA Sequence : MAAYSYRPGPGAGPGPAAGAALPDQSFLWNVFQRVDKDRSGVISDTELQQALSNGTWTPFNPVTVRSIISMFDRENKAGVNFSEFTGVWKYITDWQNVFRTYDRDNSGMIDKNELKQALSGFGYRLSDQFHDILIRKFDRQGRGQIAFDDFIQGCIVLQRLTDIFRRYDTDQDGWIQVSYEQYLSMVFSIVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name PDCD6 programmed cell death 6 [ Homo sapiens (human) ]
Official Symbol PDCD6
Synonyms PDCD6; programmed cell death 6; programmed cell death protein 6; ALG 2; apoptosis linked gene 2; PEF1B; apoptosis-linked gene-2; apoptosis-linked gene 2 protein; probable calcium-binding protein ALG-2; ALG-2; MGC9123; FLJ46208; MGC111017; MGC119050;
Gene ID 10016
mRNA Refseq NM_013232
Protein Refseq NP_037364
MIM 601057
UniProt ID O75340

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PDCD6 Products

Required fields are marked with *

My Review for All PDCD6 Products

Required fields are marked with *

0
cart-icon
0
compare icon