Recombinant Human PDCD6 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | PDCD6-2556H |
| Product Overview : | PDCD6 MS Standard C13 and N15-labeled recombinant protein (NP_037364) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | This gene encodes a calcium-binding protein belonging to the penta-EF-hand protein family. Calcium binding is important for homodimerization and for conformational changes required for binding to other protein partners. This gene product participates in T cell receptor-, Fas-, and glucocorticoid-induced programmed cell death. In mice deficient for this gene product, however, apoptosis was not blocked suggesting this gene product is functionally redundant. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is also located on the short arm of chromosome 5. |
| Molecular Mass : | 21.9 kDa |
| AA Sequence : | MAAYSYRPGPGAGPGPAAGAALPDQSFLWNVFQRVDKDRSGVISDTELQQALSNGTWTPFNPVTVRSIISMFDRENKAGVNFSEFTGVWKYITDWQNVFRTYDRDNSGMIDKNELKQALSGFGYRLSDQFHDILIRKFDRQGRGQIAFDDFIQGCIVLQRLTDIFRRYDTDQDGWIQVSYEQYLSMVFSIVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | PDCD6 programmed cell death 6 [ Homo sapiens (human) ] |
| Official Symbol | PDCD6 |
| Synonyms | PDCD6; programmed cell death 6; programmed cell death protein 6; ALG 2; apoptosis linked gene 2; PEF1B; apoptosis-linked gene-2; apoptosis-linked gene 2 protein; probable calcium-binding protein ALG-2; ALG-2; MGC9123; FLJ46208; MGC111017; MGC119050; |
| Gene ID | 10016 |
| mRNA Refseq | NM_013232 |
| Protein Refseq | NP_037364 |
| MIM | 601057 |
| UniProt ID | O75340 |
| ◆ Recombinant Proteins | ||
| PDCD6-3853H | Recombinant Human PDCD6 Protein (Phe32-Val191), N-His tagged | +Inquiry |
| PDCD6-3427H | Recombinant Human PDCD6 protein, His-tagged | +Inquiry |
| Pdcd6-4735M | Recombinant Mouse Pdcd6 Protein, Myc/DDK-tagged | +Inquiry |
| PDCD6-11187Z | Recombinant Zebrafish PDCD6 | +Inquiry |
| PDCD6-12537M | Recombinant Mouse PDCD6 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PDCD6-3359HCL | Recombinant Human PDCD6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PDCD6 Products
Required fields are marked with *
My Review for All PDCD6 Products
Required fields are marked with *
