Recombinant Human PDE10A protein, GST-tagged
Cat.No. : | PDE10A-160H |
Product Overview : | Recombinant Human PDE10A protein(NP_001124162)(434-779 aa), fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 434-779 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
AA Sequence : | KLSYHSICTSEEWQGLMQFTLPVRLCKEIELFHFDIGPFENMWPGIFVYMVHRSCGTSCFELEKLCRFIMSVKKNYRRVPYHNWKHAVTVAHCMYAILQNNHTLFTDLERKGLLIACLCHDLDHRGFSNSYLQKFDHPLAALYSTSTMEQHHFSQTVSILQLEGHNIFSTLSSSEYEQVLEIIRKAIIATDLALYFGNRKQLEEMYQTGSLNLNNQSHRDRVIGLMMTACDLCSVTKLWPVTKLTANDIYAEFWAEGDEMKKLGIQPIPMMDRDKKDEVPQGQLGFYNAVAIPCYTTLTQILPPTEPLLKACRDNLSQWEKVIRGEETATWISSPSVAQKAAASED |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | PDE10A phosphodiesterase 10A [ Homo sapiens ] |
Official Symbol | PDE10A |
Synonyms | PDE10A; phosphodiesterase 10A; cAMP and cAMP-inhibited cGMP 3,5-cyclic phosphodiesterase 10A; phosphodiesterase 10A1 (PDE10A1); dJ416F21.1 (phosphodiesterase 10A); HSPDE10A; FLJ11894; FLJ25677; |
Gene ID | 10846 |
mRNA Refseq | NM_001130690 |
Protein Refseq | NP_001124162 |
MIM | 610652 |
UniProt ID | Q9Y233 |
◆ Recombinant Proteins | ||
PDE10A-440H | Recombinant Human Phosphodiesterase 10A, GST-tagged | +Inquiry |
PDE10A-3984R | Recombinant Rat PDE10A Protein, His (Fc)-Avi-tagged | +Inquiry |
PDE10A-160H | Recombinant Human PDE10A protein, GST-tagged | +Inquiry |
PDE10A-12544M | Recombinant Mouse PDE10A Protein | +Inquiry |
PDE10A-304H | Recombinant Human PDE10A Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PDE10A-3355HCL | Recombinant Human PDE10A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PDE10A Products
Required fields are marked with *
My Review for All PDE10A Products
Required fields are marked with *
0
Inquiry Basket