Recombinant Human PDE10A protein, GST-tagged

Cat.No. : PDE10A-160H
Product Overview : Recombinant Human PDE10A protein(NP_001124162)(434-779 aa), fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 434-779 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
AA Sequence : KLSYHSICTSEEWQGLMQFTLPVRLCKEIELFHFDIGPFENMWPGIFVYMVHRSCGTSCFELEKLCRFIMSVKKNYRRVPYHNWKHAVTVAHCMYAILQNNHTLFTDLERKGLLIACLCHDLDHRGFSNSYLQKFDHPLAALYSTSTMEQHHFSQTVSILQLEGHNIFSTLSSSEYEQVLEIIRKAIIATDLALYFGNRKQLEEMYQTGSLNLNNQSHRDRVIGLMMTACDLCSVTKLWPVTKLTANDIYAEFWAEGDEMKKLGIQPIPMMDRDKKDEVPQGQLGFYNAVAIPCYTTLTQILPPTEPLLKACRDNLSQWEKVIRGEETATWISSPSVAQKAAASED
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name PDE10A phosphodiesterase 10A [ Homo sapiens ]
Official Symbol PDE10A
Synonyms PDE10A; phosphodiesterase 10A; cAMP and cAMP-inhibited cGMP 3,5-cyclic phosphodiesterase 10A; phosphodiesterase 10A1 (PDE10A1); dJ416F21.1 (phosphodiesterase 10A); HSPDE10A; FLJ11894; FLJ25677;
Gene ID 10846
mRNA Refseq NM_001130690
Protein Refseq NP_001124162
MIM 610652
UniProt ID Q9Y233

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PDE10A Products

Required fields are marked with *

My Review for All PDE10A Products

Required fields are marked with *

0
cart-icon
0
compare icon