Recombinant Human PDE4C protein, His-tagged
| Cat.No. : | PDE4C-2481H |
| Product Overview : | Recombinant Human PDE4C protein(28-91 aa), fused to His tag, was expressed in E. coli. |
| Availability | February 08, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 28-91 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | SEYISRTFLDQQTEVELPKVTAEEAPQPMSRISGLHGLCHSASLSSATVPRFGVQTDQEEQLAK |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | PDE4C phosphodiesterase 4C, cAMP-specific [ Homo sapiens ] |
| Official Symbol | PDE4C |
| Synonyms | PDE4C; phosphodiesterase 4C, cAMP-specific; DPDE1, phosphodiesterase 4C, cAMP specific (dunce (Drosophila) homolog phosphodiesterase E1); cAMP-specific 3,5-cyclic phosphodiesterase 4C; phosphodiesterase E1 dunce homolog (Drosophila); PDE21; phosphodiesterase E1 dunce homolog; phosphodiesterase 4C, cAMP-specific (phosphodiesterase E1 dunce homolog, Drosophila); DPDE1; MGC126222; |
| Gene ID | 5143 |
| mRNA Refseq | NM_000923 |
| Protein Refseq | NP_000914 |
| MIM | 600128 |
| UniProt ID | Q08493 |
| ◆ Recombinant Proteins | ||
| PDE4C-1600H | Recombinant Human PDE4C, GST-tagged | +Inquiry |
| PDE4C-6585M | Recombinant Mouse PDE4C Protein, His (Fc)-Avi-tagged | +Inquiry |
| Pde4c-470M | Recombinant Mouse Pde4c Protein, MYC/DDK-tagged | +Inquiry |
| PDE4C-12555M | Recombinant Mouse PDE4C Protein | +Inquiry |
| PDE4C-2481H | Recombinant Human PDE4C protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PDE4C-3351HCL | Recombinant Human PDE4C 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PDE4C Products
Required fields are marked with *
My Review for All PDE4C Products
Required fields are marked with *
