Recombinant Human PDE6B protein, His-tagged

• Cat.No.: PDE6B-3295H
• Product Overview: Recombinant Human PDE6B protein(198 - 428 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 198 - 428 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: GPFFTSEDEDVFLKYLNFATLYLKIYHLSYLHNCETRRGQVLLWSANKVFEELTDIERQFHKAFYTVRAYLNCERYSVGLLDMTKEKEFFDVWSVLMGESQPYSGPRTPDGREIVFYKVIDYILHGKEEIKVIPTPSADHWALASGLPSYVAESGFICNIMNASADEMFKFQEGALDDSGWLIKNVLSMPIVNKKEEIVGVATFYNRKDGKPFDEQDEVLMESLTQFLGWS
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: PDE6B phosphodiesterase 6B, cGMP-specific, rod, beta [ Homo sapiens ]
• Official Symbol: PDE6B
• Synonyms: PDE6B; phosphodiesterase 6B, cGMP-specific, rod, beta; PDEB; rod cGMP-specific 3,5-cyclic phosphodiesterase subunit beta; congenital stationary night blindness 3; autosomal dominant; CSNB3; rd1; RP40; GMP-PDE beta; rod cGMP-phosphodiesterase beta-subunit; CSNBAD2
• Gene ID: 5158
• mRNA Refseq: NM_000283
• Protein Refseq: NP_000274
• MIM: 180072
• UniProt ID: P35913