Recombinant Human PDE6B protein, GST-tagged
| Cat.No. : | PDE6B-3296H |
| Product Overview : | Recombinant Human PDE6B protein(198-428 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 198-428 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Storage : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| AA Sequence : | GPFFTSEDEDVFLKYLNFATLYLKIYHLSYLHNCETRRGQVLLWSANKVFEELTDIERQFHKAFYTVRAYLNCERYSVGLLDMTKEKEFFDVWSVLMGESQPYSGPRTPDGREIVFYKVIDYILHGKEEIKVIPTPSADHWALASGLPSYVAESGFICNIMNASADEMFKFQEGALDDSGWLIKNVLSMPIVNKKEEIVGVATFYNRKDGKPFDEQDEVLMESLTQFLGWS |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Official Symbol | PDE6B |
| Synonyms | PDE6B; phosphodiesterase 6B, cGMP-specific, rod, beta; PDEB; rod cGMP-specific 3,5-cyclic phosphodiesterase subunit beta; congenital stationary night blindness 3; autosomal dominant; CSNB3; rd1; RP40; GMP-PDE beta; rod cGMP-phosphodiesterase beta-subunit; CSNBAD2; |
| Gene ID | 5158 |
| mRNA Refseq | NM_000283 |
| Protein Refseq | NP_000274 |
| MIM | 180072 |
| UniProt ID | P35913 |
| ◆ Recombinant Proteins | ||
| PDE6B-12559M | Recombinant Mouse PDE6B Protein | +Inquiry |
| PDE6B-151H | Recombinant Human PDE6B protein, His-tagged | +Inquiry |
| PDE6B-3295H | Recombinant Human PDE6B protein, His-tagged | +Inquiry |
| PDE6B-3296H | Recombinant Human PDE6B protein, GST-tagged | +Inquiry |
| PDE6B-6588M | Recombinant Mouse PDE6B Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PDE6B-3346HCL | Recombinant Human PDE6B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PDE6B Products
Required fields are marked with *
My Review for All PDE6B Products
Required fields are marked with *
