Recombinant Human PDE6H Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | PDE6H-5259H |
Product Overview : | PDE6H MS Standard C13 and N15-labeled recombinant protein (NP_006196) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes the inhibitory (or gamma) subunit of the cone-specific cGMP phosphodiesterase, which is a tetramer composed of two catalytic chains (alpha and beta), and two inhibitory chains (gamma). It is specifically expressed in the retina, and is involved in the transmission and amplification of the visual signal. Mutations in this gene are associated with retinal cone dystrophy type 3A (RCD3A). |
Molecular Mass : | 9.1 kDa |
AA Sequence : | MSDNTTLPAPASNQGPTTPRKGPPKFKQRQTRQFKSKPPKKGVKGFGDDIPGMEGLGTDITVICPWEAFSHLELHELAQFGIITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | PDE6H phosphodiesterase 6H [ Homo sapiens (human) ] |
Official Symbol | PDE6H |
Synonyms | PDE6H; RCD3; ACHM6; phosphodiesterase 6H, cGMP-specific, cone, gamma; retinal cone rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit gamma; GMP-PDE gamma; EC 3.1.4.35 |
Gene ID | 5149 |
mRNA Refseq | NM_006205 |
Protein Refseq | NP_006196 |
MIM | 601190 |
UniProt ID | Q13956 |
◆ Recombinant Proteins | ||
PDE6H-521H | Recombinant Human PDE6H | +Inquiry |
PDE6H-4335R | Recombinant Rat PDE6H Protein | +Inquiry |
PDE6H-3995R | Recombinant Rat PDE6H Protein, His (Fc)-Avi-tagged | +Inquiry |
PDE6H-5259H | Recombinant Human PDE6H Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PDE6H-3819H | Recombinant Human PDE6H Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PDE6H-3343HCL | Recombinant Human PDE6H 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PDE6H Products
Required fields are marked with *
My Review for All PDE6H Products
Required fields are marked with *