Recombinant Human PDE6H Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: PDE6H-5259H
• Product Overview: PDE6H MS Standard C13 and N15-labeled recombinant protein (NP_006196) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes the inhibitory (or gamma) subunit of the cone-specific cGMP phosphodiesterase, which is a tetramer composed of two catalytic chains (alpha and beta), and two inhibitory chains (gamma). It is specifically expressed in the retina, and is involved in the transmission and amplification of the visual signal. Mutations in this gene are associated with retinal cone dystrophy type 3A (RCD3A).
• Molecular Mass: 9.1 kDa
• AA Sequence: MSDNTTLPAPASNQGPTTPRKGPPKFKQRQTRQFKSKPPKKGVKGFGDDIPGMEGLGTDITVICPWEAFSHLELHELAQFGIITRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: PDE6H phosphodiesterase 6H [ Homo sapiens (human) ]
• Official Symbol: PDE6H
• Synonyms: PDE6H; RCD3; ACHM6; phosphodiesterase 6H, cGMP-specific, cone, gamma; retinal cone rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit gamma; GMP-PDE gamma; EC 3.1.4.35
• Gene ID: 5149
• mRNA Refseq: NM_006205
• Protein Refseq: NP_006196
• MIM: 601190
• UniProt ID: Q13956