Recombinant Human PDF protein, His-tagged
Cat.No. : | PDF-89H |
Product Overview : | Recombinant Human PDF protein, fused to His-tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | Protein synthesis proceeds after formylation of methionine by methionyl-tRNA formyl transferase (FMT) and transfer of the charged initiator f-met tRNA to the ribosome. In eubacteria and eukaryotic organelles the product of this gene, peptide deformylase (PDF), removes the formyl group from the initiating methionine of nascent peptides. In eubacteria, deformylation of nascent peptides is required for subsequent cleavage of initiating methionines by methionine aminopeptidase. The discovery that a natural inhibitor of PDF, actinonin, acts as an antimicrobial agent in some bacteria has spurred intensive research into the design of bacterial-specific PDF inhibitors. In human cells, only mitochondrial proteins have N-formylation of initiating methionines. Protein inhibitors of PDF or siRNAs of PDF block the growth of cancer cell lines but have no effect on normal cell growth. In humans, PDF function may therefore be restricted to rapidly growing cells. |
Form : | Supplied as a 0.2 μm filtered solution in 50mM Tris-HCl pH8.0, 300mM NaCl, 50% glycerol. |
Molecular Mass : | ~24.3 kDa |
AA Sequence : | MEGPALRRSYWRHLRRLVLGPPEPPFSHVCQVGDPVLRGVAAPVERAQLGGPELQRLTQRLVQVMRRRRCVGLSAPQLGVPRQVLALELPEALCRECPPRQRALRQMEPFPLRVFVNPSLRVLDSRLVTFPEGCESVAGFLACVPRFQAVQISGLDPNGEQVVWQASGWAARIIQHEMDHLQGCLFIDKMDSRTFTNVYWMKVNDLEHHHHHH |
Purity : | >90% |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.3mg/mL |
Gene Name | PDF peptide deformylase, mitochondrial [ Homo sapiens (human) ] |
Official Symbol | |
Synonyms | Growth/differentiation factor 15; GDF-15; Placental TGF-beta; NAG-1; Macrophage inhibitory cytokine 1; MIC1; NSAID-activated gene 1 protein; PTGFB; NRG-1; MIC-1; PLAB; NSAID-regulated gene 1 protein; PDF; Prostate differentiation factor; Placental bone morphogenetic protein |
Gene ID | 64146 |
mRNA Refseq | NM_022341 |
Protein Refseq | NP_071736 |
MIM | 618720 |
UniProt ID | Q9HBH1 |
◆ Recombinant Proteins | ||
PDF-3354R | Recombinant Rhesus monkey PDF Protein, His-tagged | +Inquiry |
PDF-12H | Recombinant Human PDF protein, His-tagged | +Inquiry |
PDF-7830H | Recombinant Human PDF, GST-tagged | +Inquiry |
PDF-3172R | Recombinant Rhesus Macaque PDF Protein, His (Fc)-Avi-tagged | +Inquiry |
PDF-89H | Recombinant Human PDF protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PDF-3338HCL | Recombinant Human PDF 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PDF Products
Required fields are marked with *
My Review for All PDF Products
Required fields are marked with *
0
Inquiry Basket