Recombinant Mouse Pdgfb protein

Cat.No. : Pdgfb-55M
Product Overview : Recombinant Mouse Pdgfb protein was expressed in Escherichia coli.
Availability December 07, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : Non
Protein Length : 109
Description : This gene encodes a member of the protein family comprised of both platelet-derived growth factors (PDGF) and vascular endothelial growth factors (VEGF). The encoded preproprotein is proteolytically processed to generate platelet-derived growth factor subunit B, which can homodimerize, or alternatively, heterodimerize with the related platelet-derived growth factor subunit A. These proteins bind and activate PDGF receptor tyrosine kinases, which play a role in a wide range of developmental processes. Mutations in this gene are associated with meningioma. Reciprocal translocations between chromosomes 22 and 17, at sites where this gene and that for collagen type 1, alpha 1 are located, are associated with dermatofibrosarcoma protuberans, a rare skin tumor. Alternative splicing results in multiple transcript variants.
Form : Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 5.0.
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine Balb/c 3T3 cells is less than 1.0 ng/ml, corresponding to a specific activity of > 1.0 × 10⁶ IU/mg.
Molecular Mass : Approximately 24.4 kDa, a disulfide-linked homodimeric protein containing two 109 amino acid residues polypeptide (B chain).
AA Sequence : SLGSLAAAEPAVIAECKTRTEVFQISRNLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRASQVQMRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETIVTPRPVT
Endotoxin : Less than 0.1 EU/μg of rMuPDGF-BB as determined by LAL method.
Purity : >98% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Publications :
MiR-34a regulates Migration of Mouse Lung Fibroblasts by modulating PDGFR signalling (2019)
Gene Name Pdgfb
Official Symbol Pdgfb
Synonyms PDGFB; platelet derived growth factor, B polypeptide; platelet-derived growth factor subunit B; c-sis; PDGF-2; PDGF subunit B; proto-oncogene c-Sis; platelet-derived growth factor B chain; platelet-derived growth factor beta polypeptide; Sis; PDGF-B;
Gene ID 18591
mRNA Refseq NM_011057
Protein Refseq NP_035187
UniProt ID P31240

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Pdgfb Products

Required fields are marked with *

My Review for All Pdgfb Products

Required fields are marked with *

0
cart-icon
0
compare icon