Recombinant Human PDGFRA protein, His-tagged

• Cat.No.: PDGFRA-2884H
• Product Overview: Recombinant Human PDGFRA protein(24-123 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 24-123 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: MQLSLPSILPNENEKVVQLNSSFSLRCFGESEVSWQYPMSEEESSDVEIRNEENNSGLFVTVLEVSSASAAHTGLYTCYYNHTQTEENELEGRHIYIYVPD
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: PDGFRA platelet-derived growth factor receptor, alpha polypeptide [ Homo sapiens ]
• Official Symbol: PDGFRA
• Synonyms: PDGFRA; platelet-derived growth factor receptor, alpha polypeptide; platelet-derived growth factor receptor alpha; CD140a; PDGFR2; PDGFR-alpha; PDGF-R-alpha; CD140a antigen; PDGFRA/BCR fusion; CD140 antigen-like family member A; platelet-derived growth factor receptor 2; alpha-type platelet-derived growth factor receptor; rearranged-in-hypereosinophilia-platelet derived growth factor receptor alpha fusion protein; CD140A; PDGFR-2; RHEPDGFRA; MGC74795
• Gene ID: 5156
• mRNA Refseq: NM_006206
• Protein Refseq: NP_006197
• MIM: 173490
• UniProt ID: P16234