Recombinant Human PDGFRB Protein (33-532aa), C-hIgG-His tagged

Cat.No. : PDGFRB-129H
Product Overview : Recombinant human PDGFRB (33-532aa), fused to hIgG-His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Insect Cells
Tag : Fc&His
Protein Length : 33-532aa
Description : This gene encodes a member of the vascular endothelial growth factor receptor (VEGFR) family. VEGFR family members are receptor tyrosine kinases (RTKs) which contain an extracellular ligand-binding region with seven immunoglobulin (Ig)-like domains, a transmembrane segment, and a tyrosine kinase (TK) domain within the cytoplasmic domain. This protein binds to VEGFR-A, VEGFR-B and placental growth factor and plays an important role in angiogenesis and vasculogenesis. Expression of this receptor is found in vascular endothelial cells, placental trophoblast cells and peripheral blood monocytes. Multiple transcript variants encoding different isoforms have been found for this gene. Isoforms include a full-length transmembrane receptor isoform and shortened, soluble isoforms. The soluble isoforms are associated with the onset of pre-eclampsia.
Form : Liquid
Molecular Mass : 83.3 kDa (739aa)
AA Sequence : LVVTPPGPELVLNVSSTFVLTCSGSAPVVWERMSQEPPQEMAKAQDGTFSSVLTLTNLTGLDTGEYFCTHNDSRGLETDERKRLYIFVPDPTVGFLPNDAEELFIFLTEITEITIPCRVTDPQLVVTLHEKKGDVALPVPYDHQRGFSGIFEDRSYICKTTIGDREVDSDAYYVYRLQVSSINVSVNAVQTVVRQGENITLMCIVIGNEVVNFEWTYPRKESGRLVEPVTDFLLDMPYHIRSILHIPSAELEDSGTYTCNVTESVNDHQDEKAINITVVESGYVRLLGEVGTLQFAELHRSRTLQVVFEAYPPPTVLWFKDNRTLGDSSAGEIALSTRNVSETRYVSELTLVRVKVAEAGHYTMRAFHEDAEVQLSFQLQINVPVRVLELSESHPDSGEQTVRCRGRGMPQPNIIWSACRDLKRCPRELPPTLLGNSSEEESQLETNVTYWEEEQEFEVVSTLRLQHVDRPLSVRCTLRNAVGQDTQEVIVVPHSLPFKV< LEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH>
Endotoxin : < 1 EU/μg of protein (determined by LAL method)
Purity : > 90% by SDS-PAGE
Applications : SDS-PAGE
Storage : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 0.25 mg/mL (determined by Bradford assay)
Storage Buffer : Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol
Gene Name PDGFRB platelet-derived growth factor receptor, beta polypeptide [ Homo sapiens (human) ]
Official Symbol PDGFRB
Synonyms PDGFRB; platelet-derived growth factor receptor, beta polypeptide; PDGFR; platelet-derived growth factor receptor beta; CD140b; JTK12; PDGFR1; PDGFR-beta; PDGF-R-beta; CD140 antigen-like family member B; platelet-derived growth factor receptor 1; beta-type platelet-derived growth factor receptor; CD140B; PDGFR-1;
Gene ID 5159
mRNA Refseq NM_002609
Protein Refseq NP_002600
MIM 173410
UniProt ID P09619

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PDGFRB Products

Required fields are marked with *

My Review for All PDGFRB Products

Required fields are marked with *

0
cart-icon