Recombinant Human PDGFRL protein, His-tagged
Cat.No. : | PDGFRL-2899H |
Product Overview : | Recombinant Human PDGFRL protein(1-375 aa), fused to His tag, was expressed in E. coli. |
Availability | September 04, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-375 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MKVWLLLGLLLVHEALEDVTGQHLPKNKRPKEPGENRIKPTNKKVKPKIPKMKDRDSANSAPKTQSIMMQVLDKGRFQKPAATLSLLAGQTVELRCKGSRIGWSYPAYLDTFKDSRLSVKQNERYGQLTLVNSTSADTGEFSCWVQLCSGYICRKDEAKTGSTYIFFTEKGELFVPSPSYFDVVYLNPDRQAVVPCRVTVLSAKVTLHREFPAKEIPANGTDIVYDMKRGFVYLQPHSEHQGVVYCRAEAGGRSQISVKYQLLYVAVPSGPPSTTILASSNKVKSGDDISVLCTVLGEPDVEVEFTWIFPGQKDERPVTIQDTWRLIHRGLGHTTRISQSVITVEDFETIDAGYYICTAQNLQGQTTVATTVEFS |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | PDGFRL platelet-derived growth factor receptor-like [ Homo sapiens ] |
Official Symbol | PDGFRL |
Synonyms | PDGFRL; platelet-derived growth factor receptor-like; platelet-derived growth factor receptor-like protein; PRLTS; PDGFR-like protein; PDGF receptor beta-like tumor suppressor; platelet-derived growth factor-beta-like tumor suppressor; PDGRL; |
Gene ID | 5157 |
mRNA Refseq | NM_006207 |
Protein Refseq | NP_006198 |
MIM | 604584 |
UniProt ID | Q15198 |
◆ Recombinant Proteins | ||
PDGFRL-3822H | Recombinant Human PDGFRL Protein, His (Fc)-Avi-tagged | +Inquiry |
PDGFRL-4001R | Recombinant Rat PDGFRL Protein, His (Fc)-Avi-tagged | +Inquiry |
PDGFRL-2899H | Recombinant Human PDGFRL protein, His-tagged | +Inquiry |
PDGFRL-4341R | Recombinant Rat PDGFRL Protein | +Inquiry |
Pdgfrl-8160M | Recombinant Mouse Pdgfrl protein, His & T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PDGFRL-3334HCL | Recombinant Human PDGFRL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PDGFRL Products
Required fields are marked with *
My Review for All PDGFRL Products
Required fields are marked with *