Recombinant Human PDPK1 protein, GST-tagged
| Cat.No. : | PDPK1-1866H | 
| Product Overview : | Recombinant Human PDPK1 protein(198-556 aa), fused to GST tag, was expressed in E. coli. | 
| Availability | October 31, 2025 | 
| Unit | |
| Price | |
| Qty | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | E.coli | 
| Tag : | GST | 
| Protein Length : | 198-556 aa | 
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. | 
| AA Sequence : | GKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQARANSFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLTAYLPAMSEDDEDCYGNYDNLLSQFGCMQVSSSSSSHSLSASDTGLPQRSGSNIEQYIHDLDSNSFELDLQFSEDEKRLLLEKQAGGNPWHQFVENNLILKMGPVDKRKGLFARRRQLLLTEGPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCRKIQEVWRQRYQSHPDAAVQ | 
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. | 
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. | 
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. | 
| Gene Name | PDPK1 3-phosphoinositide dependent protein kinase-1 [ Homo sapiens ] | 
| Official Symbol | PDPK1 | 
| Synonyms | PDPK1; 3-phosphoinositide dependent protein kinase-1; 3-phosphoinositide-dependent protein kinase 1; PDK1; PkB kinase; PkB-like 1; PkB kinase like gene 1; PRO0461; MGC20087; MGC35290; | 
| Gene ID | 5170 | 
| mRNA Refseq | NM_002613 | 
| Protein Refseq | NP_002604 | 
| MIM | 605213 | 
| UniProt ID | O15530 | 
| ◆ Recombinant Proteins | ||
| PDPK1-1077H | Recombinant Human PDPK1 Protein (M51-A360), His tagged | +Inquiry | 
| PDPK1-4825H | Recombinant Human PDPK1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry | 
| PDPK1-448H | Recombinant Human PDPK1 Protein, His-tagged | +Inquiry | 
| PDPK1-4017R | Recombinant Rat PDPK1 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| PDPK1-561H | Active Recombinant Human PDPK1, GST-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| PDPK1-3322HCL | Recombinant Human PDPK1 293 Cell Lysate | +Inquiry | 
| PDPK1-3321HCL | Recombinant Human PDPK1 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PDPK1 Products
Required fields are marked with *
My Review for All PDPK1 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            