Recombinant Human PDX1 protein, Arginine-tagged

Cat.No. : PDX1-147H
Product Overview : Recombinant human PDX1 protein fused with 11 arginine domain at C-terminal, which efficiently delivery protein intracellularly, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Form : 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence : MNGEEQYYAATQLYKDPCAFQRGPAPEFSASPPACLYMGRQPPPPPPHPFPGALGALEQGSPPDISPYEVPPLAD DPAVAHLHHHLPAQLALPHPPAGPFPEGAEPGVLEEPNRVQLPFPWMKSTKAHAWKGQWAGGAYAAEPEENKRTR TAYTRAQLLELEKEFLFNKYISRPRRVELAVMLNLTERHIKIWFQNRRMKWKKEEDKKRGGGTAVGGGGVAEPEQ DCAVTSGEELLALPPPPPPGGAVPPAAPVAAREGRLPPGLSASPQPSSVAPRRPQEPRESGGGGSPQRRRRRRRR RRR
Purity : >90% by SDS-PAGE
Applications : 1. Protein transduction for pancreatic β-cells in vitro differentiation.2. Active recombinant protein, may be used for ELISA based DNA/Protein binding assay.3. As specific protein substrate for kinase assay.
Storage : Keep at -20°C for long term storage. Product is stable at 4 °C for at least 7 days.
Gene Name PDX1 pancreatic and duodenal homeobox 1 [ Homo sapiens ]
Official Symbol PDX1
Synonyms PDX1; IDX 1; MODY4; PDX 1; somatostatin transcription factor 1; STF 1; IPF-1; IUF-1; glucose-sensitive factor; insulin upstream factor 1; islet/duodenum homeobox-1; GSF; IPF1; IUF1; IDX-1; PDX-1; STF-1;
Gene ID 3651
mRNA Refseq NM_000209
Protein Refseq NP_000200
MIM 600733
UniProt ID P52945
Chromosome Location 13q12.1
Pathway Developmental Biology, organism-specific biosystem; FOXA2 and FOXA3 transcription factor networks, organism-specific biosystem; Maturity onset diabetes of the young, organism-specific biosystem; Maturity onset diabetes of the young, conserved biosystem; Regulation of beta-cell development, organism-specific biosystem; Regulation of gene expression in beta cells, organism-specific biosystem; Regulation of gene expression in early pancreatic precursor cells, organism-specific biosystem;
Function chromatin binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PDX1 Products

Required fields are marked with *

My Review for All PDX1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon