Recombinant Human PDX1 protein, Arginine-tagged

• Cat.No.: PDX1-147H
• Product Overview: Recombinant human PDX1 protein fused with 11 arginine domain at C-terminal, which efficiently delivery protein intracellularly, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Protein Length: 1-283 aa
• Form: 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
• AA Sequence: MNGEEQYYAATQLYKDPCAFQRGPAPEFSASPPACLYMGRQPPPPPPHPFPGALGALEQGSPPDISPYEVPPLAD DPAVAHLHHHLPAQLALPHPPAGPFPEGAEPGVLEEPNRVQLPFPWMKSTKAHAWKGQWAGGAYAAEPEENKRTR TAYTRAQLLELEKEFLFNKYISRPRRVELAVMLNLTERHIKIWFQNRRMKWKKEEDKKRGGGTAVGGGGVAEPEQ DCAVTSGEELLALPPPPPPGGAVPPAAPVAAREGRLPPGLSASPQPSSVAPRRPQEPRESGGGGSPQRRRRRRRR RRR
• Purity: >90% by SDS-PAGE
• Applications: 1. Protein transduction for pancreatic β-cells in vitro differentiation.2. Active recombinant protein, may be used for ELISA based DNA/Protein binding assay.3. As specific protein substrate for kinase assay.
• Storage: Keep at -20°C for long term storage. Product is stable at 4 °C for at least 7 days.

Gene Information

• Gene Name: PDX1 pancreatic and duodenal homeobox 1 [ Homo sapiens ]
• Official Symbol: PDX1
• Synonyms: PDX1; IDX 1; MODY4; PDX 1; somatostatin transcription factor 1; STF 1; IPF-1; IUF-1; glucose-sensitive factor; insulin upstream factor 1; islet/duodenum homeobox-1; GSF; IPF1; IUF1; IDX-1; PDX-1; STF-1
• Gene ID: 3651
• mRNA Refseq: NM_000209
• Protein Refseq: NP_000200
• MIM: 600733
• UniProt ID: P52945
• Chromosome Location: 13q12.1
• Pathway: Developmental Biology, organism-specific biosystem; FOXA2 and FOXA3 transcription factor networks, organism-specific biosystem; Maturity onset diabetes of the young, organism-specific biosystem; Maturity onset diabetes of the young, conserved biosystem; Regulation of beta-cell development, organism-specific biosystem; Regulation of gene expression in beta cells, organism-specific biosystem; Regulation of gene expression in early pancreatic precursor cells, organism-specific biosystem
• Function: chromatin binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity