"PDX1" Related Products

Expand
Expand
Expand

Recombinant Human PDX1 protein, Arginine-tagged

Cat.No.: PDX1-147H
Product Overview: Recombinant human PDX1 protein fused with 11 arginine domain at C-terminal, which efficiently delivery protein intracellularly, was expressed in E. coli.
Source: E. coli
Species: Human
Tag: Arginine
Form: 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence: MNGEEQYYAATQLYKDPCAFQRGPAPEFSASPPACLYMGRQPPPPPPHPFPGALGALEQGSPPDISPYEVPPLAD DPAVAHLHHHLPAQLALPHPPAGPFPEGAEPGVLEEPNRVQLPFPWMKSTKAHAWKGQWAGGAYAAEPEENKRTR TAYTRAQLLELEKEFLFNKYISRPRRVELAVMLNLTERHIKIWFQNRRMKWKKEEDKKRGGGTAVGGGGVAEPEQ DCAVTSGEELLALPPPPPPGGAVPPAAPVAAREGRLPPGLSASPQPSSVAPRRPQEPRESGGGGSPQRRRRRRRR RRR
Purity: >90% by SDS-PAGE
Applications: 1. Protein transduction for pancreatic β-cells in vitro differentiation.2. Active recombinant protein, may be used for ELISA based DNA/Protein binding assay.3. As specific protein substrate for kinase assay.
Storage: Keep at -20°C for long term storage. Product is stable at 4 °C for at least 7 days.
Gene Name: PDX1 pancreatic and duodenal homeobox 1 [ Homo sapiens ]
Official Symbol: PDX1
Synonyms: PDX1; IDX 1; MODY4; PDX 1; somatostatin transcription factor 1; STF 1; IPF-1; IUF-1; glucose-sensitive factor; insulin upstream factor 1; islet/duodenum homeobox-1; GSF; IPF1; IUF1; IDX-1; PDX-1; STF-1;
Gene ID: 3651
mRNA Refseq: NM_000209
Protein Refseq: NP_000200
MIM: 600733
UniProt ID: P52945
Chromosome Location: 13q12.1
Pathway: Developmental Biology, organism-specific biosystem; FOXA2 and FOXA3 transcription factor networks, organism-specific biosystem; Maturity onset diabetes of the young, organism-specific biosystem; Maturity onset diabetes of the young, conserved biosystem; Regulation of beta-cell development, organism-specific biosystem; Regulation of gene expression in beta cells, organism-specific biosystem; Regulation of gene expression in early pancreatic precursor cells, organism-specific biosystem;
Function: chromatin binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.