Active Recombinant Human Pepsinogen I Protein

Cat.No. : PGC-1028H
Product Overview : Recombinant Human pepsinogen I protein. Predicted molecular weight: 40 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Description : Pepsinogen is the pro-form of pepsin and is produced in the stomach by chief cells. The major part of pepsinogen is secreted into the gastric lumen but a small amount can be found in the blood. Alterations in the serum pepsinogen concentrations has been found with Helicobacter pylori (H. Pylori) infections, peptic ulcer disease, gastritis, and gastric cancer. More precise analysis may be achieved by measuring the pepsinogen I/II ratio.
Form : Lyophilized from 0.2 μm filtered solution
Bio-activity : Anti- h Pepsinogen I 8003 : + Anti- h Pepsinogen I 8015 : +
Molecular Mass : 40 kDa
AA Sequence : MIMYKVPLIRKKSLRRTLSERGLLKDFLKKHNLNPARKYFPQWEAPTLVDEQPLENYLDMEYFGTIGI GTPAQDFTVVFDTGSSNLWVPSVYCSSLACTNHNRFNPEDSSTYQSTSETVSITYGTGSMTGILGYD TVQVGGISDTNQIFGLSETEPGSFLYYAPFDGILGLAYPSISSSGATPVFDNIWNQGLVSQDLFSVYLS ADDQSGSVVIFGGIDSSYYTGSLNWVPVTVEGYWQITVDSITMNGEAIACAEGCQAIVDTGTSLLTG PTSPIANIQSDIGASENSDGDMVVSCSAISSLPDIVFTINGVQYPVPPSAYILQSEGSCISGFQGMNLPT ESGELWILGDVFIRQYFTVFDRANNQVGLAPVA
Storage : 2–8centigrade
Concentration : 0.5 mg/ml when reconstituted with 200 µl of deionized water
Storage Buffer : 50 mM Tris-HCl, pH 7.5; 150 mM NaCl, 0,5 µg/ml pepstatin A; containing 6 % sucrose as a stabilizer
Reconstitution : Reconstitute lyophilized protein with 200 µl of deionized water
Gene Name PGC progastricsin (pepsinogen C) [ Homo sapiens ]
Official Symbol PGC
Synonyms PGC; progastricsin (pepsinogen C); gastricsin; pepsin C; pepsinogen C; preprogastricsin; pepsinogen group II; PEPC; PGII; FLJ99563;
Gene ID 5225
mRNA Refseq NM_001166424
Protein Refseq NP_001159896
MIM 169740
UniProt ID P20142

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PGC Products

Required fields are marked with *

My Review for All PGC Products

Required fields are marked with *

0
cart-icon