Active Recombinant Human PF4 protein

Cat.No. : PF4-87H
Product Overview : Recombinant Human PF4 protein was expressed in Escherichia coli.
Availability June 30, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 70
Description : Platelet Factor-4 (PF-4) is a small cytokine belonging to the CXC chemokine family that is also known as chemokine (C-X-C motif) ligand 4 (CXCL4). The gene for human CXCL4 is located on human chromosome 4. This chemokine is released from alpha-granules of activated platelets during platelet aggregation and neutralizes the anticoagulant effect of heparin. It interacts with a splice variant of the chemokine receptor CXCR3 besides be chemotactic for neutrophils, fibroblasts and monocytes. Recombinant human CXCL4 contains 70 amino acids binds with high affinity to heparin. Specifically, Human and mouse CXCL4 share about a 60 % identity.
Form : Lyophilized from a 0.2μm filtered concentrated solution in 20 mM PB, 1.5 M NaCl, pH 7.4.
Bio-activity : Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human fibroblasts is in a concentration of 1.0-10 ng/ml.
Molecular Mass : Approximately 7.8 kDa, a single non-glycosylated polypeptide chain containing 70 amino acids.
AA Sequence : EAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES
Endotoxin : Less than 1 EU/μg of rHuPF-4/CXCL4 as determined by LAL method.
Purity : >97% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name PF4
Official Symbol PF4
Synonyms PF4; platelet factor 4; chemokine (C X C motif) ligand 4; CXCL4; SCYB4; iroplact; oncostatin-A; C-X-C motif chemokine 4; chemokine (C-X-C motif) ligand 4; PF-4; MGC138298;
Gene ID 5196
mRNA Refseq NM_002619
Protein Refseq NP_002610
MIM 173460
UniProt ID P02776

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PF4 Products

Required fields are marked with *

My Review for All PF4 Products

Required fields are marked with *

0
cart-icon