Recombinant Bovine PF4 protein

Cat.No. : PF4-901B
Product Overview : Recombinant Bovine PF4 protein was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Bovine
Source : E.coli
Tag : Non
Protein Length : 88
Description : Platelet Factor-4 (PF-4) is a small cytokine belonging to the CXC chemokine family that is also known as chemokine (C-X-C motif) ligand 4 (CXCL4). This chemokine is released from alpha-granules of activated platelets during platelet aggregation and neutralizes the anticoagulant effect of heparin. It interacts with a splice variant of the chemokine receptor CXCR3 besides be chemotactic for neutrophils, fibroblasts and monocytes. Recombinant bovine CXCL4 contains 88 amino acids. Specifically, Bovine and sheep CXCL4 share about an 85% identity.
Form : Lyophilized from a 0.2 μm filtered concentrated solution in 20 mM PB, 500 mM NaCl, pH 7.0.
Bio-activity : Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human neutrophils is in a concentration of 10-100ng/ml.
Molecular Mass : Approximately 9.5 kDa, a single non-glycosylated polypeptide chain containing 88 amino acids.
AA Sequence : ESSFPATFVPLPADSEGGEDEDLQCVCLKTTSGINPRHISSLEVIGAGTHCPSPQLLATKKTGRKICLDQQRPLYKKILKKLLDGDES
Endotoxin : Less than 0.1 EU/μg of rBoPF-4/CXCL4 as determined by LAL method.
Purity : >95% by SDS-PAGE and HPLC analyses.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name PF4
Official Symbol PF4
Synonyms PF4 protein; PF4
Gene ID 507790
mRNA Refseq NM_001101062.1
Protein Refseq NP_001094532.1
UniProt ID P02777

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PF4 Products

Required fields are marked with *

My Review for All PF4 Products

Required fields are marked with *

0
cart-icon
0
compare icon