Recombinant Human PFDN5 Protein(2-154aa), GST-tagged
Cat.No. : | PFDN5-6432H |
Product Overview : | Recombinant Human PFDN5 Protein(2-154aa)(Q99471), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 2-154aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 44.2kDa |
AA Sequence : | AQSINITELNLPQLEMLKNQLDQEVEFLSTSIAQLKVVQTKYVEAKDCLNVLNKSNEGKELLVPLTSSMYVPGKLHDVEHVLIDVGTGYYVEKTAEDAKDFFKRKIDFLTKQMEKIQPALQEKHAMKQAVMEMMSQKIQQLTALGAAQATAKA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | PFDN5 prefoldin subunit 5 [ Homo sapiens ] |
Official Symbol | PFDN5 |
Synonyms | PFDN5; prefoldin subunit 5; prefoldin 5; MM 1; PFD5; myc modulator-1; c-myc binding protein; MM1; MM-1; MGC5329; MGC71907; |
Gene ID | 5204 |
mRNA Refseq | NM_002624 |
Protein Refseq | NP_002615 |
MIM | 604899 |
UniProt ID | Q99471 |
◆ Recombinant Proteins | ||
PFDN5-2580H | Recombinant Human PFDN5 Protein, His-tagged | +Inquiry |
PFDN5-3200R | Recombinant Rhesus Macaque PFDN5 Protein, His (Fc)-Avi-tagged | +Inquiry |
PFDN5-6652M | Recombinant Mouse PFDN5 Protein, His (Fc)-Avi-tagged | +Inquiry |
PFDN5-6248Z | Recombinant Zebrafish PFDN5 | +Inquiry |
PFDN5-3382R | Recombinant Rhesus monkey PFDN5 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PFDN5-3278HCL | Recombinant Human PFDN5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PFDN5 Products
Required fields are marked with *
My Review for All PFDN5 Products
Required fields are marked with *
0
Inquiry Basket