Recombinant Human PFDN5 Protein(2-154aa), GST-tagged

Cat.No. : PFDN5-6432H
Product Overview : Recombinant Human PFDN5 Protein(2-154aa)(Q99471), fused with N-terminal GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 2-154aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 44.2kDa
AA Sequence : AQSINITELNLPQLEMLKNQLDQEVEFLSTSIAQLKVVQTKYVEAKDCLNVLNKSNEGKELLVPLTSSMYVPGKLHDVEHVLIDVGTGYYVEKTAEDAKDFFKRKIDFLTKQMEKIQPALQEKHAMKQAVMEMMSQKIQQLTALGAAQATAKA
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
Gene Name PFDN5 prefoldin subunit 5 [ Homo sapiens ]
Official Symbol PFDN5
Synonyms PFDN5; prefoldin subunit 5; prefoldin 5; MM 1; PFD5; myc modulator-1; c-myc binding protein; MM1; MM-1; MGC5329; MGC71907;
Gene ID 5204
mRNA Refseq NM_002624
Protein Refseq NP_002615
MIM 604899
UniProt ID Q99471

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PFDN5 Products

Required fields are marked with *

My Review for All PFDN5 Products

Required fields are marked with *

0
cart-icon
0
compare icon