Recombinant Human PFDN5 Protein(2-154aa), GST-tagged

• Cat.No.: PFDN5-6432H
• Product Overview: Recombinant Human PFDN5 Protein(2-154aa)(Q99471), fused with N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 2-154aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 44.2kDa
• AA Sequence: AQSINITELNLPQLEMLKNQLDQEVEFLSTSIAQLKVVQTKYVEAKDCLNVLNKSNEGKELLVPLTSSMYVPGKLHDVEHVLIDVGTGYYVEKTAEDAKDFFKRKIDFLTKQMEKIQPALQEKHAMKQAVMEMMSQKIQQLTALGAAQATAKA
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: PFDN5 prefoldin subunit 5 [ Homo sapiens ]
• Official Symbol: PFDN5
• Synonyms: PFDN5; prefoldin subunit 5; prefoldin 5; MM 1; PFD5; myc modulator-1; c-myc binding protein; MM1; MM-1; MGC5329; MGC71907
• Gene ID: 5204
• mRNA Refseq: NM_002624
• Protein Refseq: NP_002615
• MIM: 604899
• UniProt ID: Q99471