Recombinant Human PFN1 protein, His-tagged

• Cat.No.: PFN1-90H
• Product Overview: Recombinant Human PFN1 protein, fused to His-tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Description: This gene encodes a member of the profilin family of small actin-binding proteins. The encoded protein plays an important role in actin dynamics by regulating actin polymerization in response to extracellular signals. Deletion of this gene is associated with Miller-Dieker syndrome, and the encoded protein may also play a role in Huntington disease. Multiple pseudogenes of this gene are located on chromosome 1.
• Form: Supplied as a 0.2 μm filtered solution in 30mM Tris, 300 mM NaCl, pH9.0.
• Molecular Mass: ~16.1 kDa
• AA Sequence: MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFYVNGLTLGGQKGSVIRDSLLQDGEFSMDLRTKSTGGAPTFNVTVTKTDKTLVLLMGKEGVHGGLINKKCYEMASHLRRSQYLEHHHHHH
• Purity: >90%
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.28 mg/mL

Gene Information

• Gene Name: PFN1 profilin 1 [ Homo sapiens (human) ]
• Official Symbol: PFN1
• Synonyms: ALS18
• Gene ID: 5216
• mRNA Refseq: NM_001375991
• Protein Refseq: NP_001362920
• MIM: 176610
• UniProt ID: P07737