Recombinant Human PFN1 Protein (mutant C71G)
| Cat.No. : | PFN1-01H |
| Product Overview : | Recombinant Human PFN1 Protein (mutant C71G) without tag was expressed in E. coli. |
| Availability | January 05, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Description : | This gene encodes a member of the profilin family of small actin-binding proteins. The encoded protein plays an important role in actin dynamics by regulating actin polymerization in response to extracellular signals. Deletion of this gene is associated with Miller-Dieker syndrome, and the encoded protein may also play a role in Huntington disease. Multiple pseudogenes of this gene are located on chromosome 1. |
| Molecular Mass : | ~16.1 kDa, reducing conditions |
| AA Sequence : | MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFYVNGLTLGGQKGSVIRDSLLQDGEFSMDLRTKSTGGAPTFNVTVTKTDKTLVLLMGKEGVHGGLINKKCYEMASHLRRSQYLEHHHHHH |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 0.28 mg/mL |
| Storage Buffer : | Supplied as a 0.2 μm filtered solution in 30mM Tris, 300 mM NaCl, pH9.0 |
| Gene Name | PFN1 profilin 1 [ Homo sapiens (human) ] |
| Official Symbol | PFN1 |
| Synonyms | PFN1; profilin 1; ALS18; profilin-1; epididymis tissue protein Li 184a; profilin I |
| Gene ID | 5216 |
| mRNA Refseq | NM_005022 |
| Protein Refseq | NP_005013 |
| MIM | 176610 |
| UniProt ID | P07737 |
| ◆ Recombinant Proteins | ||
| PFN1-12667M | Recombinant Mouse PFN1 Protein | +Inquiry |
| Pfn1-4812M | Recombinant Mouse Pfn1 Protein, Myc/DDK-tagged | +Inquiry |
| PFN1-624HFL | Active Recombinant Full Length Human PFN1 Protein, C-Flag-tagged | +Inquiry |
| Pfn1-56R | Recombinant Rat Pfn1 protein, His-tagged | +Inquiry |
| PFN1-91H | Recombinant Human PFN1 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PFN1-3269HCL | Recombinant Human PFN1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PFN1 Products
Required fields are marked with *
My Review for All PFN1 Products
Required fields are marked with *
