Recombinant Human PFN1 Protein (mutant C71G)
Cat.No. : | PFN1-01H |
Product Overview : | Recombinant Human PFN1 Protein (mutant C71G) without tag was expressed in E. coli. |
Availability | September 13, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Description : | This gene encodes a member of the profilin family of small actin-binding proteins. The encoded protein plays an important role in actin dynamics by regulating actin polymerization in response to extracellular signals. Deletion of this gene is associated with Miller-Dieker syndrome, and the encoded protein may also play a role in Huntington disease. Multiple pseudogenes of this gene are located on chromosome 1. |
Molecular Mass : | ~16.1 kDa, reducing conditions |
AA Sequence : | MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFYVNGLTLGGQKGSVIRDSLLQDGEFSMDLRTKSTGGAPTFNVTVTKTDKTLVLLMGKEGVHGGLINKKCYEMASHLRRSQYLEHHHHHH |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.28 mg/mL |
Storage Buffer : | Supplied as a 0.2 μm filtered solution in 30mM Tris, 300 mM NaCl, pH9.0 |
Gene Name | PFN1 profilin 1 [ Homo sapiens (human) ] |
Official Symbol | PFN1 |
Synonyms | PFN1; profilin 1; ALS18; profilin-1; epididymis tissue protein Li 184a; profilin I |
Gene ID | 5216 |
mRNA Refseq | NM_005022 |
Protein Refseq | NP_005013 |
MIM | 176610 |
UniProt ID | P07737 |
◆ Recombinant Proteins | ||
PFN1-6655M | Recombinant Mouse PFN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PFN1-884H | Recombinant Human PFN1 Protein | +Inquiry |
PFN1-1401H | Recombinant Human Profilin 1 | +Inquiry |
PFN1-4873H | Recombinant Human PFN1 Protein (Met1-Gln139), His tagged | +Inquiry |
PFN1-429H | Recombinant Human PFN1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PFN1-3269HCL | Recombinant Human PFN1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PFN1 Products
Required fields are marked with *
My Review for All PFN1 Products
Required fields are marked with *