Recombinant Human PFN1 Protein (mutant C71G)

Cat.No. : PFN1-01H
Product Overview : Recombinant Human PFN1 Protein (mutant C71G) without tag was expressed in E. coli.
Availability December 12, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Description : This gene encodes a member of the profilin family of small actin-binding proteins. The encoded protein plays an important role in actin dynamics by regulating actin polymerization in response to extracellular signals. Deletion of this gene is associated with Miller-Dieker syndrome, and the encoded protein may also play a role in Huntington disease. Multiple pseudogenes of this gene are located on chromosome 1.
Molecular Mass : ~16.1 kDa, reducing conditions
AA Sequence : MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFYVNGLTLGGQKGSVIRDSLLQDGEFSMDLRTKSTGGAPTFNVTVTKTDKTLVLLMGKEGVHGGLINKKCYEMASHLRRSQYLEHHHHHH
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.28 mg/mL
Storage Buffer : Supplied as a 0.2 μm filtered solution in 30mM Tris, 300 mM NaCl, pH9.0
Gene Name PFN1 profilin 1 [ Homo sapiens (human) ]
Official Symbol PFN1
Synonyms PFN1; profilin 1; ALS18; profilin-1; epididymis tissue protein Li 184a; profilin I
Gene ID 5216
mRNA Refseq NM_005022
Protein Refseq NP_005013
MIM 176610
UniProt ID P07737

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PFN1 Products

Required fields are marked with *

My Review for All PFN1 Products

Required fields are marked with *

0
cart-icon
0
compare icon