Recombinant Human PFN1 protein, T7/His-tagged
Cat.No. : | PFN1-234H |
Product Overview : | Recombinant human PFN1 cDNA (2 – 140 aa) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Protein Length : | 2-140 a.a. |
Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Sucrose. |
AA Sequence : | MASMTGGQQMGRGHHHHHHENLYFQGGEFAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAE VGVLVGKDRSSFYVNGLTLGGQKCSVIRDSLLQDGEFSMDLRTKSTGGAPTFNVTVTKTDKTLVLLMGKEGVHGG LINKKCYEMASHLRRSQY |
Purity : | >90% by SDS-PAGE |
Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
Gene Name | PFN1 profilin 1 [ Homo sapiens ] |
Official Symbol | PFN1 |
Synonyms | PFN1; profilin 1; profilin-1; profilin I; |
Gene ID | 5216 |
mRNA Refseq | NM_005022 |
Protein Refseq | NP_005013 |
MIM | 176610 |
UniProt ID | P07737 |
Chromosome Location | 17p13.2 |
Pathway | Axon guidance, organism-specific biosystem; Developmental Biology, organism-specific biosystem; G13 Signaling Pathway, organism-specific biosystem; Hemostasis, organism-specific biosystem; Platelet activation, signaling and aggregation, organism-specific biosystem; Platelet degranulation, organism-specific biosystem; Regulation of Actin Cytoskeleton, organism-specific biosystem; |
Function | Rho GTPase binding; actin binding; phosphatidylinositol-4,5-bisphosphate binding; proline-rich region binding; receptor binding; |
◆ Recombinant Proteins | ||
PFN1-884H | Recombinant Human PFN1 Protein | +Inquiry |
PFN1-1658H | Recombinant Human PFN1, GST-tagged | +Inquiry |
PFN1-783C | Recombinant Cynomolgus PFN1 Protein, His-tagged | +Inquiry |
Pfn1-56R | Recombinant Rat Pfn1 protein, His-tagged | +Inquiry |
PFN1-4396R | Recombinant Rat PFN1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PFN1-3269HCL | Recombinant Human PFN1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PFN1 Products
Required fields are marked with *
My Review for All PFN1 Products
Required fields are marked with *