Recombinant Human PFN1 protein, T7/His-tagged
| Cat.No. : | PFN1-234H |
| Product Overview : | Recombinant human PFN1 cDNA (2 – 140 aa) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&T7 |
| Protein Length : | 2-140 a.a. |
| Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Sucrose. |
| AA Sequence : | MASMTGGQQMGRGHHHHHHENLYFQGGEFAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAE VGVLVGKDRSSFYVNGLTLGGQKCSVIRDSLLQDGEFSMDLRTKSTGGAPTFNVTVTKTDKTLVLLMGKEGVHGG LINKKCYEMASHLRRSQY |
| Purity : | >90% by SDS-PAGE |
| Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
| Gene Name | PFN1 profilin 1 [ Homo sapiens ] |
| Official Symbol | PFN1 |
| Synonyms | PFN1; profilin 1; profilin-1; profilin I; |
| Gene ID | 5216 |
| mRNA Refseq | NM_005022 |
| Protein Refseq | NP_005013 |
| MIM | 176610 |
| UniProt ID | P07737 |
| Chromosome Location | 17p13.2 |
| Pathway | Axon guidance, organism-specific biosystem; Developmental Biology, organism-specific biosystem; G13 Signaling Pathway, organism-specific biosystem; Hemostasis, organism-specific biosystem; Platelet activation, signaling and aggregation, organism-specific biosystem; Platelet degranulation, organism-specific biosystem; Regulation of Actin Cytoskeleton, organism-specific biosystem; |
| Function | Rho GTPase binding; actin binding; phosphatidylinositol-4,5-bisphosphate binding; proline-rich region binding; receptor binding; |
| ◆ Recombinant Proteins | ||
| PFN1-4396R | Recombinant Rat PFN1 Protein | +Inquiry |
| PFN1-884H | Recombinant Human PFN1 Protein | +Inquiry |
| PFN1-91H | Recombinant Human PFN1 protein, His-tagged | +Inquiry |
| PFN1-3332H | Recombinant Human PFN1 protein, GST-tagged | +Inquiry |
| PFN1-6655M | Recombinant Mouse PFN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PFN1-3269HCL | Recombinant Human PFN1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PFN1 Products
Required fields are marked with *
My Review for All PFN1 Products
Required fields are marked with *
