"PFN1" Related Products

Expand
Expand

Recombinant Human PFN1 protein, T7/His-tagged

Cat.No.: PFN1-234H
Product Overview: Recombinant human PFN1 cDNA (2 – 140 aa) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7/His
Form: 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Sucrose.
AA Sequence: MASMTGGQQMGRGHHHHHHENLYFQGGEFAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAE VGVLVGKDRSSFYVNGLTLGGQKCSVIRDSLLQDGEFSMDLRTKSTGGAPTFNVTVTKTDKTLVLLMGKEGVHGG LINKKCYEMASHLRRSQY
Purity: >90% by SDS-PAGE
Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name: PFN1 profilin 1 [ Homo sapiens ]
Official Symbol: PFN1
Synonyms: PFN1; profilin 1; profilin-1; profilin I;
Gene ID: 5216
mRNA Refseq: NM_005022
Protein Refseq: NP_005013
MIM: 176610
UniProt ID: P07737
Chromosome Location: 17p13.2
Pathway: Axon guidance, organism-specific biosystem; Developmental Biology, organism-specific biosystem; G13 Signaling Pathway, organism-specific biosystem; Hemostasis, organism-specific biosystem; Platelet activation, signaling and aggregation, organism-specific biosystem; Platelet degranulation, organism-specific biosystem; Regulation of Actin Cytoskeleton, organism-specific biosystem;
Function: Rho GTPase binding; actin binding; phosphatidylinositol-4,5-bisphosphate binding; proline-rich region binding; receptor binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.