Recombinant Human PFN2 Protein

Cat.No. : PFN2-644H
Product Overview : Recombinant Human PFN2, transcript variant 1, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Description : The protein encoded by this gene is a ubiquitous actin monomer-binding protein belonging to the profilin family. It is thought to regulate actin polymerization in response to extracellular signals. There are two alternatively spliced transcript variants encoding different isoforms described for this gene.
Form : Lyophilized from a 0.2 µM filtered solution of 20mM Tris, 150mM NaCl, pH 8.0
Molecular Mass : 15kD
AA Sequence : MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPIEIDMIVGKDREGFFTNGLALGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF
Endotoxin : Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Purity : >95% as determined by SDS-PAGE and Coomassie blue staining
Concentration : Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Gene Name PFN2 profilin 2 [ Homo sapiens ]
Official Symbol PFN2
Synonyms PFN2; profilin 2; profilin-2; profilin II; PFL; D3S1319E;
Gene ID 5217
mRNA Refseq NM_002628
Protein Refseq NP_002619
MIM 176590
UniProt ID P35080

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PFN2 Products

Required fields are marked with *

My Review for All PFN2 Products

Required fields are marked with *

0
cart-icon
0
compare icon