Recombinant Human PFN2 Protein
Cat.No. : | PFN2-644H |
Product Overview : | Recombinant Human PFN2, transcript variant 1, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Description : | The protein encoded by this gene is a ubiquitous actin monomer-binding protein belonging to the profilin family. It is thought to regulate actin polymerization in response to extracellular signals. There are two alternatively spliced transcript variants encoding different isoforms described for this gene. |
Form : | Lyophilized from a 0.2 µM filtered solution of 20mM Tris, 150mM NaCl, pH 8.0 |
Molecular Mass : | 15kD |
AA Sequence : | MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPIEIDMIVGKDREGFFTNGLALGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Concentration : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | PFN2 profilin 2 [ Homo sapiens ] |
Official Symbol | PFN2 |
Synonyms | PFN2; profilin 2; profilin-2; profilin II; PFL; D3S1319E; |
Gene ID | 5217 |
mRNA Refseq | NM_002628 |
Protein Refseq | NP_002619 |
MIM | 176590 |
UniProt ID | P35080 |
◆ Recombinant Proteins | ||
PFN2-12668M | Recombinant Mouse PFN2 Protein | +Inquiry |
PFN2-2228H | Recombinant Human PFN2 protein, His-tagged | +Inquiry |
PFN2-6656M | Recombinant Mouse PFN2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Pfn2-4813M | Recombinant Mouse Pfn2 Protein, Myc/DDK-tagged | +Inquiry |
PFN2-140H | Recombinant Human PFN2 protein, T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PFN2-3267HCL | Recombinant Human PFN2 293 Cell Lysate | +Inquiry |
PFN2-3268HCL | Recombinant Human PFN2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PFN2 Products
Required fields are marked with *
My Review for All PFN2 Products
Required fields are marked with *