Recombinant Human PGF

• Cat.No.: PGF-30907TH
• Product Overview: Recombinant full length Human PLGF expressed in modified human 293 cells.

Specification

• Species: Human
• Tag: Non
• Description: This gene encodes a growth factor found in placenta which is homologous to vascular endothelial growth factor. Alternatively spliced transcripts encoding different isoforms have been found for this gene.
• Form: Lyophilised:It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.Following reconstitution short-term storage at 4°C is recommended, with longer-term storage in aliquots at -18 to -20°C. Repeated freeze thawing is not rec
• Purity: >95% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 10% Trehalose, 1% Human serum albumin
• Storage: Store at +4°C.
• Sequences of amino acids: Theoretical Sequence:LPAVPPQQWALSAGNGSSEVEVVPFQEVW GRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTG CCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFS QHVRCECRPLREKMKPERCGDAVPRR
• Full Length: Full L.

Gene Information

• Gene Name: PGF placental growth factor [ Homo sapiens ]
• Official Symbol: PGF
• Synonyms: PGF; placental growth factor; PGFL, placental growth factor, vascular endothelial growth factor related protein , placental growth factor like; placenta growth factor; D12S1900; PlGF; PLGF; PlGF 2; SHGC 10760
• Gene ID: 5228
• mRNA Refseq: NM_001207012
• Protein Refseq: NP_001193941
• MIM: 601121
• Uniprot ID: P49763
• Chromosome Location: 14q24.3
• Pathway: Bladder cancer, organism-specific biosystem; Bladder cancer, conserved biosystem; Focal Adhesion, organism-specific biosystem; Focal adhesion, organism-specific biosystem; Focal adhesion, conserved biosystem
• Function: growth factor activity; heparin binding