Recombinant Human PGF
Cat.No. : | PGF-30907TH |
Product Overview : | Recombinant full length Human PLGF expressed in modified human 293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Tag : | Non |
Description : | This gene encodes a growth factor found in placenta which is homologous to vascular endothelial growth factor. Alternatively spliced transcripts encoding different isoforms have been found for this gene. |
Form : | Lyophilised:It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.Following reconstitution short-term storage at 4°C is recommended, with longer-term storage in aliquots at -18 to -20°C. Repeated freeze thawing is not rec |
Purity : | >95% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 10% Trehalose, 1% Human serum albumin |
Storage : | Store at +4°C. |
Sequences of amino acids : | Theoretical Sequence:LPAVPPQQWALSAGNGSSEVEVVPFQEVW GRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTG CCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFS QHVRCECRPLREKMKPERCGDAVPRR |
Full Length : | Full L. |
Gene Name | PGF placental growth factor [ Homo sapiens ] |
Official Symbol | PGF |
Synonyms | PGF; placental growth factor; PGFL, placental growth factor, vascular endothelial growth factor related protein , placental growth factor like; placenta growth factor; D12S1900; PlGF; PLGF; PlGF 2; SHGC 10760; |
Gene ID | 5228 |
mRNA Refseq | NM_001207012 |
Protein Refseq | NP_001193941 |
MIM | 601121 |
Uniprot ID | P49763 |
Chromosome Location | 14q24.3 |
Pathway | Bladder cancer, organism-specific biosystem; Bladder cancer, conserved biosystem; Focal Adhesion, organism-specific biosystem; Focal adhesion, organism-specific biosystem; Focal adhesion, conserved biosystem; |
Function | growth factor activity; heparin binding; |
◆ Recombinant Proteins | ||
PGF-98H | Recombinant Human Placental Growth Factor | +Inquiry |
PGF-4635H | Recombinant Human PGF protein, hFc-tagged | +Inquiry |
PGF-29H | Active Recombinant Human PGF protein, His-tagged | +Inquiry |
Pgf-6053MFL | Recombinant Full Length Mouse Pgf, Flag-tagged | +Inquiry |
PGF-2583H | Recombinant Human PGF Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PGF-1118MCL | Recombinant Mouse PGF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PGF Products
Required fields are marked with *
My Review for All PGF Products
Required fields are marked with *
0
Inquiry Basket