| Species : |
Human |
| Source : |
Wheat Germ |
| Tag : |
Non |
| Protein Length : |
272 amino acids |
| Description : |
Prohibitin is an evolutionarily conserved gene that is ubiquitously expressed.It is thought to be a negative regulator of cell proliferation and may be a tumor suppressor.Mutations in PHB have been linked to sporadic breast cancer.Prohibitin is expressed as two transcripts with varying lengths of 3 untranslated region.The longer transcript is present at higher levels in proliferating tissues and cells, suggesting that this longer 3 untranslated region may function as a trans-acting regulatory RNA. |
| Molecular Weight : |
55.660kDa inclusive of tags |
| Tissue specificity : |
Widely expressed in different tissues. |
| Form : |
Liquid |
| Purity : |
Proprietary Purification |
| Storage buffer : |
pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
| Storage : |
Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : |
MAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVVFD RFRGVQDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVIT GSKDLQNVNITLRILFRPVASQLPRIFTSIGEDYDERVLP SITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAAT FGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVV EKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRK LEAAGDIAYQLSRSRNITYLPAGQSVLLQLPQ |
| Sequence Similarities : |
Belongs to the prohibitin family. |