Recombinant Human PHB
Cat.No. : | PHB-29709TH |
Product Overview : | Recombinant full length Human Prohibitin with an N terminal proprietary tag; Predicted MWt 55.66 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 272 amino acids |
Description : | Prohibitin is an evolutionarily conserved gene that is ubiquitously expressed.It is thought to be a negative regulator of cell proliferation and may be a tumor suppressor.Mutations in PHB have been linked to sporadic breast cancer.Prohibitin is expressed as two transcripts with varying lengths of 3 untranslated region.The longer transcript is present at higher levels in proliferating tissues and cells, suggesting that this longer 3 untranslated region may function as a trans-acting regulatory RNA. |
Molecular Weight : | 55.660kDa inclusive of tags |
Tissue specificity : | Widely expressed in different tissues. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVVFD RFRGVQDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVIT GSKDLQNVNITLRILFRPVASQLPRIFTSIGEDYDERVLP SITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAAT FGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVV EKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRK LEAAGDIAYQLSRSRNITYLPAGQSVLLQLPQ |
Sequence Similarities : | Belongs to the prohibitin family. |
Gene Name | PHB prohibitin [ Homo sapiens ] |
Official Symbol | PHB |
Synonyms | PHB; prohibitin; PHB1; |
Gene ID | 5245 |
mRNA Refseq | NM_002634 |
Protein Refseq | NP_002625 |
MIM | 176705 |
Uniprot ID | P35232 |
Chromosome Location | 17q21 |
Function | histone deacetylase binding; protein binding; transcription regulatory region DNA binding; |
◆ Recombinant Proteins | ||
PHB-4887H | Recombinant Human PHB Protein (Lys177-Gln272), N-His tagged | +Inquiry |
PHB-2606M | Recombinant Mouse PHB Protein (41-173 aa), His-tagged | +Inquiry |
Phb-4832M | Recombinant Mouse Phb Protein, Myc/DDK-tagged | +Inquiry |
PHB-181H | Recombinant Human PHB protein, T7/His-tagged | +Inquiry |
PHB-29709TH | Recombinant Human PHB | +Inquiry |
◆ Cell & Tissue Lysates | ||
PHB-3241HCL | Recombinant Human PHB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PHB Products
Required fields are marked with *
My Review for All PHB Products
Required fields are marked with *
0
Inquiry Basket