Recombinant Mouse Phb protein, His-tagged
| Cat.No. : | Phb-3337M |
| Product Overview : | Recombinant Mouse Phb protein(P67778)(174-272aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 174-272aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 16.2 kDa |
| AA Sequence : | TFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRKLEAAEDIAYQLSRSRNITYLPAGQSVLLQLPQ |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | Phb prohibitin [ Mus musculus ] |
| Official Symbol | Phb |
| Synonyms | PHB; prohibitin; B-cell receptor-associated protein 32; Bap32; |
| Gene ID | 18673 |
| mRNA Refseq | NM_008831 |
| Protein Refseq | NP_032857 |
| ◆ Recombinant Proteins | ||
| PHB-2606M | Recombinant Mouse PHB Protein (41-173 aa), His-tagged | +Inquiry |
| Phb-3336M | Recombinant Mouse Phb protein, His-tagged | +Inquiry |
| PHB-3855B | Recombinant Burkholderia pickettii PHB protein, His-tagged | +Inquiry |
| PHB-1938H | Recombinant Human PHB Protein, His&GST-tagged | +Inquiry |
| PHB-11445Z | Recombinant Zebrafish PHB | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PHB-3241HCL | Recombinant Human PHB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Phb Products
Required fields are marked with *
My Review for All Phb Products
Required fields are marked with *
