Recombinant Human PHB Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | PHB-1257H |
Product Overview : | PHB MS Standard C13 and N15-labeled recombinant protein (NP_002625) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene is evolutionarily conserved, and its product is proposed to play a role in human cellular senescence and tumor suppression. Antiproliferative activity is reported to be localized to the 3' UTR, which is proposed to function as a trans-acting regulatory RNA. Several pseudogenes of this gene have been identified. Alternative splicing results in multiple transcript variants. |
Molecular Mass : | 29.6 kDa |
AA Sequence : | MAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVIFDRFRGVQDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLPRIFTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRKLEAAEDIAYQLSRSRNITYLPAGQSVLLQLPQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | PHB prohibitin [ Homo sapiens (human) ] |
Official Symbol | PHB |
Synonyms | PHB; prohibitin; PHB1; HEL-215; HEL-S-54e; prohibitin; epididymis luminal protein 215; epididymis secretory sperm binding protein Li 54e |
Gene ID | 5245 |
mRNA Refseq | NM_002634 |
Protein Refseq | NP_002625 |
MIM | 176705 |
UniProt ID | P35232 |
◆ Recombinant Proteins | ||
PHB-29709TH | Recombinant Human PHB | +Inquiry |
Phb-4832M | Recombinant Mouse Phb Protein, Myc/DDK-tagged | +Inquiry |
PHB-3855B | Recombinant Burkholderia pickettii PHB protein, His-tagged | +Inquiry |
PHB-12708M | Recombinant Mouse PHB Protein | +Inquiry |
PHB-6677M | Recombinant Mouse PHB Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PHB-3241HCL | Recombinant Human PHB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PHB Products
Required fields are marked with *
My Review for All PHB Products
Required fields are marked with *
0
Inquiry Basket