Recombinant Human PHB Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | PHB-1257H |
| Product Overview : | PHB MS Standard C13 and N15-labeled recombinant protein (NP_002625) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | This gene is evolutionarily conserved, and its product is proposed to play a role in human cellular senescence and tumor suppression. Antiproliferative activity is reported to be localized to the 3' UTR, which is proposed to function as a trans-acting regulatory RNA. Several pseudogenes of this gene have been identified. Alternative splicing results in multiple transcript variants. |
| Molecular Mass : | 29.6 kDa |
| AA Sequence : | MAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVIFDRFRGVQDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLPRIFTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRKLEAAEDIAYQLSRSRNITYLPAGQSVLLQLPQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | PHB prohibitin [ Homo sapiens (human) ] |
| Official Symbol | PHB |
| Synonyms | PHB; prohibitin; PHB1; HEL-215; HEL-S-54e; prohibitin; epididymis luminal protein 215; epididymis secretory sperm binding protein Li 54e |
| Gene ID | 5245 |
| mRNA Refseq | NM_002634 |
| Protein Refseq | NP_002625 |
| MIM | 176705 |
| UniProt ID | P35232 |
| ◆ Recombinant Proteins | ||
| PHB-1938H | Recombinant Human PHB Protein, His&GST-tagged | +Inquiry |
| PHB-2606M | Recombinant Mouse PHB Protein (41-173 aa), His-tagged | +Inquiry |
| PHB-3855B | Recombinant Burkholderia pickettii PHB protein, His-tagged | +Inquiry |
| Phb-4832M | Recombinant Mouse Phb Protein, Myc/DDK-tagged | +Inquiry |
| PHB-371HF | Recombinant Full Length Human PHB Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PHB-3241HCL | Recombinant Human PHB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PHB Products
Required fields are marked with *
My Review for All PHB Products
Required fields are marked with *
