Recombinant Human PHB Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: PHB-1257H
• Product Overview: PHB MS Standard C13 and N15-labeled recombinant protein (NP_002625) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene is evolutionarily conserved, and its product is proposed to play a role in human cellular senescence and tumor suppression. Antiproliferative activity is reported to be localized to the 3' UTR, which is proposed to function as a trans-acting regulatory RNA. Several pseudogenes of this gene have been identified. Alternative splicing results in multiple transcript variants.
• Molecular Mass: 29.6 kDa
• AA Sequence: MAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVIFDRFRGVQDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLPRIFTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRKLEAAEDIAYQLSRSRNITYLPAGQSVLLQLPQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: PHB prohibitin [ Homo sapiens (human) ]
• Official Symbol: PHB
• Synonyms: PHB; prohibitin; PHB1; HEL-215; HEL-S-54e; prohibitin; epididymis luminal protein 215; epididymis secretory sperm binding protein Li 54e
• Gene ID: 5245
• mRNA Refseq: NM_002634
• Protein Refseq: NP_002625
• MIM: 176705
• UniProt ID: P35232