Recombinant Mouse PHB Protein (41-173 aa), His-tagged
Cat.No. : | PHB-2606M |
Product Overview : | Recombinant Mouse PHB Protein (41-173 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal. Research Area: Transcription. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 41-173 aa |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 20.5 kDa |
AA Sequence : | RFRGVQDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLPRIYTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGLILDDVSLTHL |
Purity : | > 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | Phb prohibitin [ Mus musculus ] |
Official Symbol | PHB |
Synonyms | PHB; prohibitin; B-cell receptor-associated protein 32; Bap32; |
Gene ID | 18673 |
mRNA Refseq | NM_008831 |
Protein Refseq | NP_032857 |
UniProt ID | P67778 |
◆ Recombinant Proteins | ||
PHB-7543H | Recombinant Human PHB, His-tagged | +Inquiry |
PHB-4077R | Recombinant Rat PHB Protein, His (Fc)-Avi-tagged | +Inquiry |
PHB-4088C | Recombinant Chicken PHB | +Inquiry |
Phb-3337M | Recombinant Mouse Phb protein, His-tagged | +Inquiry |
PHB-3400R | Recombinant Rhesus monkey PHB Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PHB-3241HCL | Recombinant Human PHB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PHB Products
Required fields are marked with *
My Review for All PHB Products
Required fields are marked with *