Recombinant Mouse PHB Protein (41-173 aa), His-tagged

• Cat.No.: PHB-2606M
• Product Overview: Recombinant Mouse PHB Protein (41-173 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal. Research Area: Transcription. Protein Description: Partial.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Protein Length: 41-173 aa
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 20.5 kDa
• AA Sequence: RFRGVQDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLPRIYTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGLILDDVSLTHL
• Purity: > 85% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: Phb prohibitin [ Mus musculus ]
• Official Symbol: PHB
• Synonyms: PHB; prohibitin; B-cell receptor-associated protein 32; Bap32
• Gene ID: 18673
• mRNA Refseq: NM_008831
• Protein Refseq: NP_032857
• UniProt ID: P67778