Recombinant Human PHF11 protein, GST-tagged
Cat.No. : | PHF11-3338H |
Product Overview : | Recombinant Human PHF11 protein(Q9UIL8)(1-292aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-292aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 60.5 kDa |
AA Sequence : | MEKRTCALCPKDVEYNVLYFAQSENIAAHENCLLYSSGLVECEDQDPLNPDRSFDVESVKKEIQRGRKLKCKFCHKRGATVGCDLKNCNKNYHFFCAKKDDAVPQSDGVRGIYKLLCQQHAQFPIIAQSAKFSGVKRKRGRKKPLSGNHVQPPETMKCNTFIRQVKEEHGRHTDATVKVPFLKKCKEAGLLNYLLEEILDKVHSIPEKLMDETTSESDYEEIGSALFDCRLFEDTFVNFQAAIEKKIHASQQRWQQLKEEIELLQDLKQTLCSFQENRDLMSSSTSISSLSY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | PHF11 PHD finger protein 11 [ Homo sapiens ] |
Official Symbol | PHF11 |
Synonyms | PHF11; PHD finger protein 11; BCAP; IgE responsiveness (atopic); IGER; NY REN 34; NY-REN-34 antigen; renal carcinoma antigen NY-REN-34; BRCA1 C-terminus-associated protein; APY; IGEL; IGHER; NYREN34; NY-REN-34; RP11-185C18.3; |
Gene ID | 51131 |
mRNA Refseq | NM_001040443 |
Protein Refseq | NP_001035533 |
MIM | 607796 |
UniProt ID | Q9UIL8 |
◆ Recombinant Proteins | ||
PHF11-3338H | Recombinant Human PHF11 protein, GST-tagged | +Inquiry |
PHF11-12716M | Recombinant Mouse PHF11 Protein | +Inquiry |
PHF11-497H | Recombinant Human PHF11 Protein, His-tagged | +Inquiry |
PHF11-4420R | Recombinant Rat PHF11 Protein | +Inquiry |
PHF11-351H | Recombinant Human PHD finger protein 11, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PHF11-3237HCL | Recombinant Human PHF11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PHF11 Products
Required fields are marked with *
My Review for All PHF11 Products
Required fields are marked with *