Recombinant Human PHF11 protein, GST-tagged
Cat.No. : | PHF11-3338H |
Product Overview : | Recombinant Human PHF11 protein(Q9UIL8)(1-292aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
ProteinLength : | 1-292aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 60.5 kDa |
AA Sequence : | MEKRTCALCPKDVEYNVLYFAQSENIAAHENCLLYSSGLVECEDQDPLNPDRSFDVESVKKEIQRGRKLKCKFCHKRGATVGCDLKNCNKNYHFFCAKKDDAVPQSDGVRGIYKLLCQQHAQFPIIAQSAKFSGVKRKRGRKKPLSGNHVQPPETMKCNTFIRQVKEEHGRHTDATVKVPFLKKCKEAGLLNYLLEEILDKVHSIPEKLMDETTSESDYEEIGSALFDCRLFEDTFVNFQAAIEKKIHASQQRWQQLKEEIELLQDLKQTLCSFQENRDLMSSSTSISSLSY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | PHF11 PHD finger protein 11 [ Homo sapiens ] |
Official Symbol | PHF11 |
Synonyms | PHF11; PHD finger protein 11; BCAP; IgE responsiveness (atopic); IGER; NY REN 34; NY-REN-34 antigen; renal carcinoma antigen NY-REN-34; BRCA1 C-terminus-associated protein; APY; IGEL; IGHER; NYREN34; NY-REN-34; RP11-185C18.3; |
Gene ID | 51131 |
mRNA Refseq | NM_001040443 |
Protein Refseq | NP_001035533 |
MIM | 607796 |
UniProt ID | Q9UIL8 |
◆ Recombinant Proteins | ||
DNAAF2-2394H | Recombinant Human DNAAF2 Protein, MYC/DDK-tagged | +Inquiry |
KRT19-4396H | Recombinant Human KRT19 Protein (Met1-Leu400), C-His tagged | +Inquiry |
BTG4-10322H | Recombinant Human BTG4, GST-tagged | +Inquiry |
PCMT1-195H | Recombinant Human PCMT1 protein | +Inquiry |
AMIGO1-308R | Recombinant Rat AMIGO1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
C. abortus-35 | Native Chlamydia abortus Antigen | +Inquiry |
Immunoglobulin G3-83H | Native Human Immunoglobulin G3 | +Inquiry |
PRC1-5267P | Active Native Yeast PRC1 Protein | +Inquiry |
PLAU -15H | Native Human HMW urokinase, HRP conjugate | +Inquiry |
fH-10R | Native Rat fH Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SW620-019WCY | Human Colon Adenocarcinoma SW620 Whole Cell Lysate | +Inquiry |
SPRN-1496HCL | Recombinant Human SPRN 293 Cell Lysate | +Inquiry |
C3orf27-245HCL | Recombinant Human C3orf27 cell lysate | +Inquiry |
PGM2-3251HCL | Recombinant Human PGM2 293 Cell Lysate | +Inquiry |
HDAC8-691HCL | Recombinant Human HDAC8 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PHF11 Products
Required fields are marked with *
My Review for All PHF11 Products
Required fields are marked with *
0
Inquiry Basket