Recombinant Human PHF20L1 protein, GST-tagged
Cat.No. : | PHF20L1-5422H |
Product Overview : | Recombinant Human PHF20L1 protein(188-329 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 188-329 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | HPDLHLWACSGKRKDQDQIIAGVEKKIAQDTVNREEKKYVQNHKEPPRLPLKMEGTYITSEHSYQKPQSFGQDCKSLADPGSSDDDDVSSLEEEQEFHMRSKNSLQYSAKEHGMPEKNPAEGNTVFVYNDKKGTEDPGDSHL |
Purity : | 80%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | PHF20L1 PHD finger protein 20-like 1 [ Homo sapiens ] |
Official Symbol | PHF20L1 |
Synonyms | PHF20L1; PHD finger protein 20-like 1; PHD finger protein 20-like protein 1; CGI 72; FLJ13649; FLJ21615; MGC64923; tudor domain-containing protein PHF20L1; CGI-72; |
Gene ID | 51105 |
mRNA Refseq | NM_016018 |
Protein Refseq | NP_057102 |
UniProt ID | A8MW92 |
◆ Recombinant Proteins | ||
PHF20L1-5422H | Recombinant Human PHF20L1 protein, GST-tagged | +Inquiry |
PHF20L1-2734H | Recombinant Human PHF20L1 protein, His-tagged | +Inquiry |
PHF20L1-6690M | Recombinant Mouse PHF20L1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PHF20L1-12726M | Recombinant Mouse PHF20L1 Protein | +Inquiry |
PHF20L1-3342C | Recombinant Chicken PHF20L1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
PHF20L1-3231HCL | Recombinant Human PHF20L1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PHF20L1 Products
Required fields are marked with *
My Review for All PHF20L1 Products
Required fields are marked with *