Recombinant Human PHF20L1 protein, His-tagged
| Cat.No. : | PHF20L1-2734H |
| Product Overview : | Recombinant Human PHF20L1 protein(800-941 aa), fused to His tag, was expressed in E. coli. |
| Availability | February 08, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 800-941 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | HPDLHLWACSGKRKDQDQIIAGVEKKIAQDTVNREEKKYVQNHKEPPRLPLKMEGTYITSEHSYQKPQSFGQDCKSLADPGSSDDDDVSSLEEEQEFHMRSKNSLQYSAKEHGMPEKNPAEGNTVFVYNDKKGTEDPGDSH L |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | PHF20L1 PHD finger protein 20-like 1 [ Homo sapiens ] |
| Official Symbol | PHF20L1 |
| Synonyms | PHF20L1; PHD finger protein 20-like 1; PHD finger protein 20-like protein 1; CGI 72; FLJ13649; FLJ21615; MGC64923; tudor domain-containing protein PHF20L1; CGI-72; |
| Gene ID | 51105 |
| mRNA Refseq | NM_016018 |
| Protein Refseq | NP_057102 |
| UniProt ID | A8MW92 |
| ◆ Recombinant Proteins | ||
| PHF20L1-3342C | Recombinant Chicken PHF20L1 | +Inquiry |
| PHF20L1-2734H | Recombinant Human PHF20L1 protein, His-tagged | +Inquiry |
| PHF20L1-6690M | Recombinant Mouse PHF20L1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PHF20L1-5422H | Recombinant Human PHF20L1 protein, GST-tagged | +Inquiry |
| PHF20L1-12726M | Recombinant Mouse PHF20L1 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PHF20L1-3231HCL | Recombinant Human PHF20L1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PHF20L1 Products
Required fields are marked with *
My Review for All PHF20L1 Products
Required fields are marked with *
