Recombinant Human PI3 protein, His-SUMO-tagged
| Cat.No. : | PI3-3340H |
| Product Overview : | Recombinant Human PI3 protein(P19957)(61-117aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 61-117aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 22 kDa |
| AA Sequence : | AQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | PI3 peptidase inhibitor 3, skin-derived [ Homo sapiens ] |
| Official Symbol | PI3 |
| Synonyms | PI3; peptidase inhibitor 3, skin-derived; protease inhibitor 3, skin derived (SKALP); elafin; cementoin; ELAFIN; ESI; SKALP; skin derived antileukoproteinase; trappin 2; WAP3; WFDC14; PI-3; trappin-2; pre-elafin; protease inhibitor WAP3; elastase-specific inhibitor; skin-derived antileukoproteinase; WAP four-disulfide core domain 14; WAP four-disulfide core domain protein 14; protease inhibitor 3, skin-derived (SKALP); MGC13613; |
| Gene ID | 5266 |
| mRNA Refseq | NM_002638 |
| Protein Refseq | NP_002629 |
| MIM | 182257 |
| UniProt ID | P19957 |
| ◆ Recombinant Proteins | ||
| PI3-4890H | Recombinant Human PI3 Protein (Phe41-Gln117), N-His tagged | +Inquiry |
| PI3-212H | Recombinant Human PI3 Protein, His-tagged | +Inquiry |
| PI3-15888H | Recombinant Human PI3 , His-tagged | +Inquiry |
| PI3-3237R | Recombinant Rhesus Macaque PI3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PI3-01H | Recombinant Human PI3 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PI3-2035HCL | Recombinant Human PI3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PI3 Products
Required fields are marked with *
My Review for All PI3 Products
Required fields are marked with *
