Recombinant Human PI4KB protein, His-tagged

Cat.No. : PI4KB-1702H
Product Overview : Recombinant Human PI4KB protein(505-801 aa), fused with His Tag, was expressed in E. coli.
Availability February 05, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 505-801 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : AFKRDPEDPSAVALKEPWQEKVRRIREGSPYGHLPNWRLLSVIVKCGDDLRQELLAFQVLKQLQSIWEQERVPLWIKPYKILVISADSGMIEPVVNAVSIHQVKKQSQLSLLDYFLQEHGSYTTEAFLSAQRNFVQSCAGYCLVCYLLQVKDRHNGNILLDAEGHIIHIDFGFILSSSPRNLGFETSAFKLTTEFVDVMGGLDGDMFNYYKMLMLQGLIAARKHMDKVVQIVEIMQQGSQLPCFHGSSTIRNLKERFHMSMTEEQLQLLVEQMVDGSMRSITTKLYDGFQYLTNGIM
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name PI4KB phosphatidylinositol 4-kinase, catalytic, beta [ Homo sapiens ]
Official Symbol PI4KB
Synonyms PI4KB; phosphatidylinositol 4-kinase, catalytic, beta; PIK4CB; phosphatidylinositol 4-kinase beta; PI4K BETA; pi4K92; PtdIns 4-kinase beta; type III phosphatidylinositol 4-kinase beta; phosphatidylinositol 4-kinase, wortmannin-sensitive; NPIK; PI4K92; PI4KBETA; PI4K-BETA; PI4KIIIBETA; FLJ30129; DKFZp686O1820;
Gene ID 5298
mRNA Refseq NM_001198773
Protein Refseq NP_001185702
MIM 602758
UniProt ID Q9UBF8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PI4KB Products

Required fields are marked with *

My Review for All PI4KB Products

Required fields are marked with *

0
cart-icon
0
compare icon