Recombinant Human PIEZO1 protein, His&Myc-tagged
Cat.No. : | PIEZO1-4643H |
Product Overview : | Recombinant Human PIEZO1 protein(Q92508)(2198-2431aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 2198-2431a.a. |
Tag : | His&Myc |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 33.6 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | RSVVGVVNQPIDVTVTLKLGGYEPLFTMSAQQPSIIPFTAQAYEELSRQFDPQPLAMQFISQYSPEDIVTAQIEGSSGALWRISPPSRAQMKRELYNGTADITLRFTWNFQRDLAKGGTVEYANEKHMLALAPNSTARRQLASLLEGTSDQSVVIPNLFPKYIRAPNGPEANPVKQLQPNEEADYLGVRIQLRREQGAGATGFLEWWVIELQECRTDCNLLPMVIFSDKVSPPS |
Gene Name | PIEZO1 piezo-type mechanosensitive ion channel component 1 [ Homo sapiens ] |
Official Symbol | PIEZO1 |
Synonyms | PIEZO1; piezo-type mechanosensitive ion channel component 1; FAM38A, family with sequence similarity 38, member A; KIAA0233; protein PIEZO1; family with sequence similarity 38, member A; membrane protein induced by beta-amyloid treatment; Mib; FAM38A; |
Gene ID | 9780 |
mRNA Refseq | NM_001142864 |
Protein Refseq | NP_001136336 |
MIM | 611184 |
UniProt ID | Q92508 |
◆ Recombinant Proteins | ||
PIEZO1-4106R | Recombinant Rat PIEZO1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PIEZO1-4578HF | Recombinant Full Length Human PIEZO1 Protein, GST-tagged | +Inquiry |
PIEZO1-3750H | Recombinant Human PIEZO1 Protein, GST-tagged | +Inquiry |
PIEZO1-4643H | Recombinant Human PIEZO1 protein, His&Myc-tagged | +Inquiry |
PIEZO1-4446R | Recombinant Rat PIEZO1 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PIEZO1 Products
Required fields are marked with *
My Review for All PIEZO1 Products
Required fields are marked with *
0
Inquiry Basket