Recombinant Human PIGP Protein, GST-tagged
Cat.No. : | PIGP-4026H |
Product Overview : | Human DSCR5 partial ORF ( NP_710149, 77 a.a. - 134 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes an enzyme involved in the first step of glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor is a glycolipid found on many blood cells that serves to anchor proteins to the cell surface. The encoded protein is a component of the GPI-N-acetylglucosaminyltransferase complex that catalyzes the transfer of N-acetylglucosamine (GlcNAc) from UDP-GlcNAc to phosphatidylinositol (PI). This gene is located in the Down Syndrome critical region on chromosome 21 and is a candidate for the pathogenesis of Down syndrome. This gene has multiple pseudogenes and is a member of the phosphatidylinositol glycan anchor biosynthesis gene family. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Feb 2016] |
Molecular Mass : | 32.12 kDa |
AA Sequence : | NMMSTSPLDSIHTITDNYAKNQQQKKYQEEAIPALRDISISEVNQMFFLAAKELYTKN |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | PIGP phosphatidylinositol glycan anchor biosynthesis, class P [ Homo sapiens ] |
Official Symbol | PIGP |
Synonyms | PIGP; phosphatidylinositol glycan anchor biosynthesis, class P; Down syndrome critical region gene 5 , DSCR5, phosphatidylinositol glycan, class P; phosphatidylinositol N-acetylglucosaminyltransferase subunit P; DCRC; DSRC; phosphatidylinositol n acetylglucosaminyltranferase subunit; PIG-P; Down syndrome critical region gene 5; phosphatidylinositol glycan, class P; Down syndrome critical region protein 5; Down syndrome critical region protein C; phosphatidylinositol-glycan biosynthesis class P protein; phosphatidylinositol-n-acetylglucosaminyltranferase subunit; DSCR5; DCRC-S; |
Gene ID | 51227 |
mRNA Refseq | NM_153681 |
Protein Refseq | NP_710148 |
MIM | 605938 |
UniProt ID | P57054 |
◆ Cell & Tissue Lysates | ||
PIGP-3195HCL | Recombinant Human PIGP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PIGP Products
Required fields are marked with *
My Review for All PIGP Products
Required fields are marked with *