Recombinant Human PIGP protein, His-tagged
Cat.No. : | PIGP-3113H |
Product Overview : | Recombinant Human PIGP protein(70-134 aa), fused to His tag, was expressed in E. coli. |
Availability | August 01, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 70-134 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | YVLLFGINMMSTSPLDSIHTITDNYAKNQQQKKYQEEAIPALRDISISEVNQMFFLAAKELYTKN |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | PIGP phosphatidylinositol glycan anchor biosynthesis, class P [ Homo sapiens ] |
Official Symbol | PIGP |
Synonyms | PIGP; phosphatidylinositol glycan anchor biosynthesis, class P; Down syndrome critical region gene 5 , DSCR5, phosphatidylinositol glycan, class P; phosphatidylinositol N-acetylglucosaminyltransferase subunit P; DCRC; DSRC; phosphatidylinositol n acetylglucosaminyltranferase subunit; PIG-P; Down syndrome critical region gene 5; phosphatidylinositol glycan, class P; Down syndrome critical region protein 5; Down syndrome critical region protein C; phosphatidylinositol-glycan biosynthesis class P protein; phosphatidylinositol-n-acetylglucosaminyltranferase subunit; DSCR5; DCRC-S; |
Gene ID | 51227 |
mRNA Refseq | NM_153681 |
Protein Refseq | NP_710148 |
MIM | 605938 |
UniProt ID | P57054 |
◆ Cell & Tissue Lysates | ||
PIGP-3195HCL | Recombinant Human PIGP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PIGP Products
Required fields are marked with *
My Review for All PIGP Products
Required fields are marked with *