Recombinant Human PIK3AP1 Protein, His tagged

Cat.No. : PIK3AP1-001H
Product Overview : Recombinant Human PIK3AP1 protein (462-650 aa) with His tag was expressed in E. coli.
Availability August 16, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 462-650 aa
Description : Predicted to enable phosphatidylinositol 3-kinase regulatory subunit binding activity and signaling receptor binding activity. Predicted to be involved in positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction; regulation of inflammatory response; and regulation of innate immune response. Predicted to be located in membrane. Predicted to be active in cytosol.
Molecular Mass : 23 kDa
AA Sequence : MLQASTSNPIPGDGFSRATKDSMIRKFLEGNSMGMTNLERDQCHLGQEEDVYHTVDDDEAFSVDLASRPPVPVPRPETTAPGAHQLPDNEPYIFKVFAEKSQERPGNFYVSSESIRKGPPVRPWRDRPQSSIYDPFAGMKTPGQRQLITLQEQVKLGIVNVDEAVLHFKEWQLNQKKRSESFRFQQENLHHHHHHHH
Endotoxin : < 1 EU/μg by LAL.
Purity : > 90 % by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Storage Buffer : Sterile PBS, pH8.3, 10 % Glycerol, 8 % Trehalose
Concentration : 1 mg/mL by BCA
Gene Name PIK3AP1 phosphoinositide-3-kinase adaptor protein 1 [ Homo sapiens (human) ]
Official Symbol PIK3AP1
Synonyms PIK3AP1; phosphoinositide-3-kinase adaptor protein 1; phosphoinositide 3-kinase adapter protein 1; BCAP; FLJ35564; B cell adaptor protein; B-cell adapter for phosphoinositide 3-kinase; B-cell phosphoinositide 3-kinase adapter protein 1; RP11-34E5.3
Gene ID 118788
mRNA Refseq NM_152309
Protein Refseq NP_689522
MIM 607942
UniProt ID Q6ZUJ8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PIK3AP1 Products

Required fields are marked with *

My Review for All PIK3AP1 Products

Required fields are marked with *

0
cart-icon