Recombinant Human PIK3AP1 Protein, His tagged
Cat.No. : | PIK3AP1-001H |
Product Overview : | Recombinant Human PIK3AP1 protein (462-650 aa) with His tag was expressed in E. coli. |
Availability | April 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 462-650 aa |
Description : | Predicted to enable phosphatidylinositol 3-kinase regulatory subunit binding activity and signaling receptor binding activity. Predicted to be involved in positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction; regulation of inflammatory response; and regulation of innate immune response. Predicted to be located in membrane. Predicted to be active in cytosol. |
Molecular Mass : | 23 kDa |
AA Sequence : | MLQASTSNPIPGDGFSRATKDSMIRKFLEGNSMGMTNLERDQCHLGQEEDVYHTVDDDEAFSVDLASRPPVPVPRPETTAPGAHQLPDNEPYIFKVFAEKSQERPGNFYVSSESIRKGPPVRPWRDRPQSSIYDPFAGMKTPGQRQLITLQEQVKLGIVNVDEAVLHFKEWQLNQKKRSESFRFQQENLHHHHHHHH |
Endotoxin : | < 1 EU/μg by LAL. |
Purity : | > 90 % by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Sterile PBS, pH8.3, 10 % Glycerol, 8 % Trehalose |
Concentration : | 1 mg/mL by BCA |
Gene Name | PIK3AP1 phosphoinositide-3-kinase adaptor protein 1 [ Homo sapiens (human) ] |
Official Symbol | PIK3AP1 |
Synonyms | PIK3AP1; phosphoinositide-3-kinase adaptor protein 1; phosphoinositide 3-kinase adapter protein 1; BCAP; FLJ35564; B cell adaptor protein; B-cell adapter for phosphoinositide 3-kinase; B-cell phosphoinositide 3-kinase adapter protein 1; RP11-34E5.3 |
Gene ID | 118788 |
mRNA Refseq | NM_152309 |
Protein Refseq | NP_689522 |
MIM | 607942 |
UniProt ID | Q6ZUJ8 |
◆ Recombinant Proteins | ||
PIK3AP1-1677H | Recombinant Human PIK3AP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PIK3AP1-3249R | Recombinant Rhesus Macaque PIK3AP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PIK3AP1-001H | Recombinant Human PIK3AP1 Protein, His tagged | +Inquiry |
PIK3AP1-1728H | Recombinant Human PIK3AP1 protein, His & T7-tagged | +Inquiry |
PIK3AP1-3431R | Recombinant Rhesus monkey PIK3AP1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PIK3AP1-3192HCL | Recombinant Human PIK3AP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PIK3AP1 Products
Required fields are marked with *
My Review for All PIK3AP1 Products
Required fields are marked with *
0
Inquiry Basket