Recombinant Human PIK3AP1 Protein, His tagged

• Cat.No.: PIK3AP1-001H
• Product Overview: Recombinant Human PIK3AP1 protein (462-650 aa) with His tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 462-650 aa
• Description: Predicted to enable phosphatidylinositol 3-kinase regulatory subunit binding activity and signaling receptor binding activity. Predicted to be involved in positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction; regulation of inflammatory response; and regulation of innate immune response. Predicted to be located in membrane. Predicted to be active in cytosol.
• Molecular Mass: 23 kDa
• AA Sequence: MLQASTSNPIPGDGFSRATKDSMIRKFLEGNSMGMTNLERDQCHLGQEEDVYHTVDDDEAFSVDLASRPPVPVPRPETTAPGAHQLPDNEPYIFKVFAEKSQERPGNFYVSSESIRKGPPVRPWRDRPQSSIYDPFAGMKTPGQRQLITLQEQVKLGIVNVDEAVLHFKEWQLNQKKRSESFRFQQENLHHHHHHHH
• Endotoxin: < 1 EU/μg by LAL.
• Purity: > 90 % by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Sterile PBS, pH8.3, 10 % Glycerol, 8 % Trehalose
• Concentration: 1 mg/mL by BCA

Gene Information

• Gene Name: PIK3AP1 phosphoinositide-3-kinase adaptor protein 1 [ Homo sapiens (human) ]
• Official Symbol: PIK3AP1
• Synonyms: PIK3AP1; phosphoinositide-3-kinase adaptor protein 1; phosphoinositide 3-kinase adapter protein 1; BCAP; FLJ35564; B cell adaptor protein; B-cell adapter for phosphoinositide 3-kinase; B-cell phosphoinositide 3-kinase adapter protein 1; RP11-34E5.3
• Gene ID: 118788
• mRNA Refseq: NM_152309
• Protein Refseq: NP_689522
• MIM: 607942
• UniProt ID: Q6ZUJ8