Recombinant Human PIK3C2B protein, GST-tagged
Cat.No. : | PIK3C2B-1871H |
Product Overview : | Recombinant Human PIK3C2B protein(1-350 aa), fused to GST tag, was expressed in E. coli. |
Availability | September 17, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-350 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | MSSTQGNGEHWKSLESVGISRKELAMAEALQMEYDALSRLRHDKEENRAKQNADPSLISWDEPGVDFYSKPAGRRTDLKLLRGLSGSDPTLNYNSLSPQEGPPNHSTSQGPQPGSDPWPKGSLSGDYLYIFDGSDGGVSSSPGPGDIEGSCKKLSPPPLPPRASIWDTPPLPPRKGSPSSSKISQPSDINTFSLVEQLPGKLLEHRILEEEEVLGGGGQGRLLGSVDYDGINDAITRLNLKSTYDAEMLRDATRGWKEGRGPLDFSKDTSGKPVARSKTMPPQVPPRTYASRYGNRKNATPGKNRRISAAPVGSRPHTVANGHELFEVSEERDEEVAAFCHMLDILRSGS |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | PIK3C2B phosphoinositide-3-kinase, class 2, beta polypeptide [ Homo sapiens ] |
Official Symbol | PIK3C2B |
Synonyms | PIK3C2B; phosphoinositide-3-kinase, class 2, beta polypeptide; phosphatidylinositol-4-phosphate 3-kinase C2 domain-containing subunit beta; C2 PI3K; PI3K C2beta; PI3K-C2beta; PI3K-C2-beta; PTDINS-3-kinase C2 beta; ptdIns-3-kinase C2 subunit beta; phosphoinositide 3-kinase-C2-beta; phosphatidylinositol 3-kinase C2 domain-containing beta polypeptide; C2-PI3K; DKFZp686G16234; |
Gene ID | 5287 |
mRNA Refseq | NM_002646 |
Protein Refseq | NP_002637 |
MIM | 602838 |
UniProt ID | O00750 |
◆ Recombinant Proteins | ||
PIK3C2B-1716H | Recombinant Human PIK3C2B, His-tagged | +Inquiry |
PIK3C2B-164H | Active Recombinant Human PIK3C2B protein, GST-tagged | +Inquiry |
Pik3c2b-4862M | Recombinant Mouse Pik3c2b Protein, Myc/DDK-tagged | +Inquiry |
Pik3c2b-1722R | Recombinant Rat Pik3c2b protein, His & T7-tagged | +Inquiry |
PIK3C2B-118H | Recombinant Human PIK3C2B, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PIK3C2B Products
Required fields are marked with *
My Review for All PIK3C2B Products
Required fields are marked with *