Recombinant Human PIK3C2B protein, GST-tagged

Cat.No. : PIK3C2B-1871H
Product Overview : Recombinant Human PIK3C2B protein(1-350 aa), fused to GST tag, was expressed in E. coli.
Availability September 17, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-350 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
AA Sequence : MSSTQGNGEHWKSLESVGISRKELAMAEALQMEYDALSRLRHDKEENRAKQNADPSLISWDEPGVDFYSKPAGRRTDLKLLRGLSGSDPTLNYNSLSPQEGPPNHSTSQGPQPGSDPWPKGSLSGDYLYIFDGSDGGVSSSPGPGDIEGSCKKLSPPPLPPRASIWDTPPLPPRKGSPSSSKISQPSDINTFSLVEQLPGKLLEHRILEEEEVLGGGGQGRLLGSVDYDGINDAITRLNLKSTYDAEMLRDATRGWKEGRGPLDFSKDTSGKPVARSKTMPPQVPPRTYASRYGNRKNATPGKNRRISAAPVGSRPHTVANGHELFEVSEERDEEVAAFCHMLDILRSGS
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name PIK3C2B phosphoinositide-3-kinase, class 2, beta polypeptide [ Homo sapiens ]
Official Symbol PIK3C2B
Synonyms PIK3C2B; phosphoinositide-3-kinase, class 2, beta polypeptide; phosphatidylinositol-4-phosphate 3-kinase C2 domain-containing subunit beta; C2 PI3K; PI3K C2beta; PI3K-C2beta; PI3K-C2-beta; PTDINS-3-kinase C2 beta; ptdIns-3-kinase C2 subunit beta; phosphoinositide 3-kinase-C2-beta; phosphatidylinositol 3-kinase C2 domain-containing beta polypeptide; C2-PI3K; DKFZp686G16234;
Gene ID 5287
mRNA Refseq NM_002646
Protein Refseq NP_002637
MIM 602838
UniProt ID O00750

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PIK3C2B Products

Required fields are marked with *

My Review for All PIK3C2B Products

Required fields are marked with *

0
cart-icon
0
compare icon