Recombinant Human PIK3CD protein, GST-tagged
Cat.No. : | PIK3CD-301404H |
Product Overview : | Recombinant Human PIK3CD (395-580 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Tyr395-Leu580 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | YAVIEKAKKARSTKKKSKKADCPIAWANLMLFDYKDQLKTGERCLYMWPSVPDEKGELLNPTGTVRSNPNTDSAAALLICLPEVAPHPVYYPALEKILELGRHSECVHVTEEEQLQLREILERRGSGELYEHEKDLVWKLRHEVQEHFPEALARLLLVTKWNKHEDVAQMLYLLCSWPELPVLSAL |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | PIK3CD phosphoinositide-3-kinase, catalytic, delta polypeptide [ Homo sapiens ] |
Official Symbol | PIK3CD |
Synonyms | PIK3CD; phosphoinositide-3-kinase, catalytic, delta polypeptide; phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit delta isoform; p110D; phosphatidylinositol 3 kinase; catalytic; delta polypeptide; phosphoinositide 3 kinase C; PI3Kdelta; phosphoinositide-3-kinase C; PI3-kinase p110 subunit delta; ptdIns-3-kinase subunit p110-delta; phosphoinositide-3-kinase, catalytic, delta polypeptide variant p37delta; phosphatidylinositol-4,5-bisphosphate 3-kinase 110 kDa catalytic subunit delta; PI3K; P110DELTA; |
Gene ID | 5293 |
mRNA Refseq | NM_005026 |
Protein Refseq | NP_005017 |
MIM | 602839 |
UniProt ID | O00329 |
◆ Recombinant Proteins | ||
PIK3CD-1989C | Recombinant Chicken PIK3CD | +Inquiry |
PIK3CD-1727H | Recombinant Human PIK3CD protein, His & T7-tagged | +Inquiry |
PIK3CD-11416Z | Recombinant Zebrafish PIK3CD | +Inquiry |
PIK3CD-29587TH | Recombinant Human PIK3CD | +Inquiry |
PIK3CD-4900H | Recombinant Human PIK3CD Protein (Val774-Gln1044), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PIK3CD-3187HCL | Recombinant Human PIK3CD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PIK3CD Products
Required fields are marked with *
My Review for All PIK3CD Products
Required fields are marked with *