Recombinant Human PIK3CD protein, GST-tagged

Cat.No. : PIK3CD-301404H
Product Overview : Recombinant Human PIK3CD (395-580 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Tyr395-Leu580
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : YAVIEKAKKARSTKKKSKKADCPIAWANLMLFDYKDQLKTGERCLYMWPSVPDEKGELLNPTGTVRSNPNTDSAAALLICLPEVAPHPVYYPALEKILELGRHSECVHVTEEEQLQLREILERRGSGELYEHEKDLVWKLRHEVQEHFPEALARLLLVTKWNKHEDVAQMLYLLCSWPELPVLSAL
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name PIK3CD phosphoinositide-3-kinase, catalytic, delta polypeptide [ Homo sapiens ]
Official Symbol PIK3CD
Synonyms PIK3CD; phosphoinositide-3-kinase, catalytic, delta polypeptide; phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit delta isoform; p110D; phosphatidylinositol 3 kinase; catalytic; delta polypeptide; phosphoinositide 3 kinase C; PI3Kdelta; phosphoinositide-3-kinase C; PI3-kinase p110 subunit delta; ptdIns-3-kinase subunit p110-delta; phosphoinositide-3-kinase, catalytic, delta polypeptide variant p37delta; phosphatidylinositol-4,5-bisphosphate 3-kinase 110 kDa catalytic subunit delta; PI3K; P110DELTA;
Gene ID 5293
mRNA Refseq NM_005026
Protein Refseq NP_005017
MIM 602839
UniProt ID O00329

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PIK3CD Products

Required fields are marked with *

My Review for All PIK3CD Products

Required fields are marked with *

0
cart-icon
0
compare icon