Recombinant Human PILRB protein, GST-tagged
Cat.No. : | PILRB-1722H |
Product Overview : | Recombinant Human PILRB(1 a.a. - 227 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 81 a.a. - 180 a.a. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 36.74 kDa |
AA Sequence : | FYSTRPPSIHKDYVNRLFLNWTEGQESGFLRISNLRKEDQSVYFCRVELDTRRSGRQQLQSIKGTKLTITQAVTT TTTWRPSSTTTIAGLRVTESKGHSE |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | PILRB paired immunoglobin-like type 2 receptor beta [ Homo sapiens ] |
Official Symbol | PILRB |
Synonyms | PILRB; paired immunoglobin-like type 2 receptor beta; paired immunoglobulin-like type 2 receptor beta; FDFACT1; FDFACT2; activating receptor PILRbeta; cell surface receptor FDFACT; activating receptor PILR-beta; cell surface receptor FDFACT1; cell surface receptor FDFACT2; paired immunoglobin-like receptor beta; paired immunoglobulin-like receptor beta; |
Gene ID | 29990 |
mRNA Refseq | NM_178238 |
Protein Refseq | NP_839956 |
MIM | 605342 |
UniProt ID | Q9UKJ0 |
Chromosome Location | 7q22.1 |
Pathway | B Cell Receptor Signaling Pathway, organism-specific biosystem; IL-3 Signaling Pathway, organism-specific biosystem; |
Function | protein binding; receptor activity; |
◆ Recombinant Proteins | ||
PILRB-521H | Recombinant Human PILRB Protein, His-tagged | +Inquiry |
PILRB-1720H | Recombinant Human PILRB, GST-tagged | +Inquiry |
PILRB-1722H | Recombinant Human PILRB protein, GST-tagged | +Inquiry |
PILRB-638HF | Recombinant Full Length Human PILRB Protein, GST-tagged | +Inquiry |
PILRB-636HF | Recombinant Full Length Human PILRB Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PILRB Products
Required fields are marked with *
My Review for All PILRB Products
Required fields are marked with *