Recombinant Human PITPNA Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : PITPNA-778H
Product Overview : PITPNA MS Standard C13 and N15-labeled recombinant protein (NP_006215) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a member of a family of lipid-binding proteins that transfer molecules of phosphatidylinositol or phosphatidylcholine between membrane surfaces. The protein is implicated in phospholipase C signaling and in the production of phosphatidylinositol 3,4,5-trisphosphate (PIP3) by phosphoinositide-3-kinase.
Molecular Mass : 31.8 kDa
AA Sequence : MVLLKEYRVILPVSVDEYQVGQLYSVAEASKNETGGGEGVEVLVNEPYEKDGEKGQYTHKIYHLQSKVPTFVRMLAPEGALNIHEKAWNAYPYCRTVITNEYMKEDFLIKIETWHKPDLGTQENVHKLEPEAWKHVEAVYIDIADRSQVLSKDYKAEEDPAKFKSIKTGRGPLGPNWKQELVNQKDCPYMCAYKLVTVKFKWWGLQNKVENFIHKQERRLFTNFHRQLFCWLDKWVDLTMDDIRRMEEETKRQLDEMRQKDPVKGMTADDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name PITPNA phosphatidylinositol transfer protein alpha [ Homo sapiens (human) ]
Official Symbol PITPNA
Synonyms PITPNA; phosphatidylinositol transfer protein, alpha; phosphotidylinositol transfer protein, PITPN; phosphatidylinositol transfer protein alpha isoform; VIB1A; PI-TP-alpha; ptdInsTP alpha; ptdIns transfer protein alpha; PITPN; PI-TPalpha; MGC99649;
Gene ID 5306
mRNA Refseq NM_006224
Protein Refseq NP_006215
MIM 600174
UniProt ID Q00169

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PITPNA Products

Required fields are marked with *

My Review for All PITPNA Products

Required fields are marked with *

0
cart-icon