Recombinant Human PITPNA Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: PITPNA-778H
• Product Overview: PITPNA MS Standard C13 and N15-labeled recombinant protein (NP_006215) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes a member of a family of lipid-binding proteins that transfer molecules of phosphatidylinositol or phosphatidylcholine between membrane surfaces. The protein is implicated in phospholipase C signaling and in the production of phosphatidylinositol 3,4,5-trisphosphate (PIP3) by phosphoinositide-3-kinase.
• Molecular Mass: 31.8 kDa
• AA Sequence: MVLLKEYRVILPVSVDEYQVGQLYSVAEASKNETGGGEGVEVLVNEPYEKDGEKGQYTHKIYHLQSKVPTFVRMLAPEGALNIHEKAWNAYPYCRTVITNEYMKEDFLIKIETWHKPDLGTQENVHKLEPEAWKHVEAVYIDIADRSQVLSKDYKAEEDPAKFKSIKTGRGPLGPNWKQELVNQKDCPYMCAYKLVTVKFKWWGLQNKVENFIHKQERRLFTNFHRQLFCWLDKWVDLTMDDIRRMEEETKRQLDEMRQKDPVKGMTADDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: PITPNA phosphatidylinositol transfer protein alpha [ Homo sapiens (human) ]
• Official Symbol: PITPNA
• Synonyms: PITPNA; phosphatidylinositol transfer protein, alpha; phosphotidylinositol transfer protein, PITPN; phosphatidylinositol transfer protein alpha isoform; VIB1A; PI-TP-alpha; ptdInsTP alpha; ptdIns transfer protein alpha; PITPN; PI-TPalpha; MGC99649
• Gene ID: 5306
• mRNA Refseq: NM_006224
• Protein Refseq: NP_006215
• MIM: 600174
• UniProt ID: Q00169