Recombinant Human PITPNA Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | PITPNA-778H |
Product Overview : | PITPNA MS Standard C13 and N15-labeled recombinant protein (NP_006215) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a member of a family of lipid-binding proteins that transfer molecules of phosphatidylinositol or phosphatidylcholine between membrane surfaces. The protein is implicated in phospholipase C signaling and in the production of phosphatidylinositol 3,4,5-trisphosphate (PIP3) by phosphoinositide-3-kinase. |
Molecular Mass : | 31.8 kDa |
AA Sequence : | MVLLKEYRVILPVSVDEYQVGQLYSVAEASKNETGGGEGVEVLVNEPYEKDGEKGQYTHKIYHLQSKVPTFVRMLAPEGALNIHEKAWNAYPYCRTVITNEYMKEDFLIKIETWHKPDLGTQENVHKLEPEAWKHVEAVYIDIADRSQVLSKDYKAEEDPAKFKSIKTGRGPLGPNWKQELVNQKDCPYMCAYKLVTVKFKWWGLQNKVENFIHKQERRLFTNFHRQLFCWLDKWVDLTMDDIRRMEEETKRQLDEMRQKDPVKGMTADDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | PITPNA phosphatidylinositol transfer protein alpha [ Homo sapiens (human) ] |
Official Symbol | PITPNA |
Synonyms | PITPNA; phosphatidylinositol transfer protein, alpha; phosphotidylinositol transfer protein, PITPN; phosphatidylinositol transfer protein alpha isoform; VIB1A; PI-TP-alpha; ptdInsTP alpha; ptdIns transfer protein alpha; PITPN; PI-TPalpha; MGC99649; |
Gene ID | 5306 |
mRNA Refseq | NM_006224 |
Protein Refseq | NP_006215 |
MIM | 600174 |
UniProt ID | Q00169 |
◆ Recombinant Proteins | ||
PITPNA-4473R | Recombinant Rat PITPNA Protein | +Inquiry |
PITPNA-4913H | Recombinant Human PITPNA Protein (Met1-Asp270), N-His tagged | +Inquiry |
PITPNA-4133R | Recombinant Rat PITPNA Protein, His (Fc)-Avi-tagged | +Inquiry |
PLA2G1B-898H | Recombinant Human PLA2G1B, His-tagged | +Inquiry |
PITPNA-3381H | Recombinant Human PITPNA, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PITPNA-3167HCL | Recombinant Human PITPNA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PITPNA Products
Required fields are marked with *
My Review for All PITPNA Products
Required fields are marked with *