Recombinant Human PITPNB Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | PITPNB-1226H |
Product Overview : | PITPNB MS Standard C13 and N15-labeled recombinant protein (NP_036531) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a cytoplasmic protein that catalyzes the transfer of phosphatidylinositol and phosphatidylcholine between membranes. This transfer activity is required for COPI complex-mediated retrograde transport from the Golgi apparatus to the endoplasmic reticulum. Alternative splicing of this gene results in multiple transcript variants. |
Molecular Mass : | 31.5 kDa |
AA Sequence : | MVLIKEFRVVLPCSVQEYQVGQLYSVAEASKNETGGGEGIEVLKNEPYEKDGEKGQYTHKIYHLKSKVPAFVRMIAPEGSLVFHEKAWNAYPYCRTIVTNEYMKDDFFIKIETWHKPDLGTLENVHGLDPNTWKTVEIVHIDIADRSQVEPADYKADEDPALFQSVKTKRGPLGPNWKKELANSPDCPQMCAYKLVTIKFKWWGLQSKVENFIQKQEKRIFTNFHRQLFCWIDKWIDLTMEDIRRMEDETQKELETMRKRGSVRGTSAADVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | PITPNB phosphatidylinositol transfer protein beta [ Homo sapiens (human) ] |
Official Symbol | PITPNB |
Synonyms | PITPNB; phosphatidylinositol transfer protein, beta; phosphatidylinositol transfer protein beta isoform; VIB1B; ptdInsTP beta; PtdIns transfer protein beta; phosphotidylinositol transfer protein, beta; PtdInsTP; PI-TP-beta; |
Gene ID | 23760 |
mRNA Refseq | NM_012399 |
Protein Refseq | NP_036531 |
MIM | 606876 |
UniProt ID | P48739 |
◆ Recombinant Proteins | ||
PITPNB-1733H | Recombinant Human PITPNB, GST-tagged | +Inquiry |
PITPNB-3330C | Recombinant Chicken PITPNB | +Inquiry |
PITPNB-12844M | Recombinant Mouse PITPNB Protein | +Inquiry |
PITPNB-2866H | Recombinant Human PITPNB, His-tagged | +Inquiry |
PITPNB-3260R | Recombinant Rhesus Macaque PITPNB Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PITPNB-3166HCL | Recombinant Human PITPNB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PITPNB Products
Required fields are marked with *
My Review for All PITPNB Products
Required fields are marked with *
0
Inquiry Basket