Recombinant Human PITPNB Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | PITPNB-1226H |
| Product Overview : | PITPNB MS Standard C13 and N15-labeled recombinant protein (NP_036531) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | This gene encodes a cytoplasmic protein that catalyzes the transfer of phosphatidylinositol and phosphatidylcholine between membranes. This transfer activity is required for COPI complex-mediated retrograde transport from the Golgi apparatus to the endoplasmic reticulum. Alternative splicing of this gene results in multiple transcript variants. |
| Molecular Mass : | 31.5 kDa |
| AA Sequence : | MVLIKEFRVVLPCSVQEYQVGQLYSVAEASKNETGGGEGIEVLKNEPYEKDGEKGQYTHKIYHLKSKVPAFVRMIAPEGSLVFHEKAWNAYPYCRTIVTNEYMKDDFFIKIETWHKPDLGTLENVHGLDPNTWKTVEIVHIDIADRSQVEPADYKADEDPALFQSVKTKRGPLGPNWKKELANSPDCPQMCAYKLVTIKFKWWGLQSKVENFIQKQEKRIFTNFHRQLFCWIDKWIDLTMEDIRRMEDETQKELETMRKRGSVRGTSAADVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | PITPNB phosphatidylinositol transfer protein beta [ Homo sapiens (human) ] |
| Official Symbol | PITPNB |
| Synonyms | PITPNB; phosphatidylinositol transfer protein, beta; phosphatidylinositol transfer protein beta isoform; VIB1B; ptdInsTP beta; PtdIns transfer protein beta; phosphotidylinositol transfer protein, beta; PtdInsTP; PI-TP-beta; |
| Gene ID | 23760 |
| mRNA Refseq | NM_012399 |
| Protein Refseq | NP_036531 |
| MIM | 606876 |
| UniProt ID | P48739 |
| ◆ Recombinant Proteins | ||
| PITPNB-4474R | Recombinant Rat PITPNB Protein | +Inquiry |
| PITPNB-2866H | Recombinant Human PITPNB, His-tagged | +Inquiry |
| PITPNB-6764M | Recombinant Mouse PITPNB Protein, His (Fc)-Avi-tagged | +Inquiry |
| PITPNB-1733H | Recombinant Human PITPNB, GST-tagged | +Inquiry |
| PITPNB-11161Z | Recombinant Zebrafish PITPNB | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PITPNB-3166HCL | Recombinant Human PITPNB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PITPNB Products
Required fields are marked with *
My Review for All PITPNB Products
Required fields are marked with *
