Recombinant Human PITPNB Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : PITPNB-1226H
Product Overview : PITPNB MS Standard C13 and N15-labeled recombinant protein (NP_036531) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a cytoplasmic protein that catalyzes the transfer of phosphatidylinositol and phosphatidylcholine between membranes. This transfer activity is required for COPI complex-mediated retrograde transport from the Golgi apparatus to the endoplasmic reticulum. Alternative splicing of this gene results in multiple transcript variants.
Molecular Mass : 31.5 kDa
AA Sequence : MVLIKEFRVVLPCSVQEYQVGQLYSVAEASKNETGGGEGIEVLKNEPYEKDGEKGQYTHKIYHLKSKVPAFVRMIAPEGSLVFHEKAWNAYPYCRTIVTNEYMKDDFFIKIETWHKPDLGTLENVHGLDPNTWKTVEIVHIDIADRSQVEPADYKADEDPALFQSVKTKRGPLGPNWKKELANSPDCPQMCAYKLVTIKFKWWGLQSKVENFIQKQEKRIFTNFHRQLFCWIDKWIDLTMEDIRRMEDETQKELETMRKRGSVRGTSAADVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name PITPNB phosphatidylinositol transfer protein beta [ Homo sapiens (human) ]
Official Symbol PITPNB
Synonyms PITPNB; phosphatidylinositol transfer protein, beta; phosphatidylinositol transfer protein beta isoform; VIB1B; ptdInsTP beta; PtdIns transfer protein beta; phosphotidylinositol transfer protein, beta; PtdInsTP; PI-TP-beta;
Gene ID 23760
mRNA Refseq NM_012399
Protein Refseq NP_036531
MIM 606876
UniProt ID P48739

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PITPNB Products

Required fields are marked with *

My Review for All PITPNB Products

Required fields are marked with *

0
cart-icon