Recombinant Human PITX1
| Cat.No. : | PITX1-28302TH |
| Product Overview : | Recombinant full length Human PITX1 with N terminal proprietary tag; Predicted MW 60.61kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 314 amino acids |
| Description : | This gene encodes a member of the RIEG/PITX homeobox family, which is in the bicoid class of homeodomain proteins. Members of this family are involved in organ development and left-right asymmetry. This protein acts as a transcriptional regulator involved in basal and hormone-regulated activity of prolactin. |
| Molecular Weight : | 60.610kDa inclusive of tags |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MDAFKGGMSLERLPEGLRPPPPPPHDMGPAFHLARPADPR EPLENSASESSDTELPEKERGGEPKGPEDSGAGGTGCGGA DDPAKKKKQRRQRTHFTSQQLQELEATFQRNRYPDMSMRE EIAVWTNLTEPRVRVWFKNRRAKWRKRERNQQLDLCKGGY VPQFSGLVQPYEDVYAAGYSYNNWAAKSLAPAPLSTKSFT FFNSMSPLSSQSMFSAPSSISSMTMPSSMGPGAVPGMPNS GLNNINNLTGSSLNSAMSPGACPYGTPASPYSVYRDTCNS SLASLRLKSKQHSSFGYGALQGPASGLNACQYNS |
| Sequence Similarities : | Belongs to the paired homeobox family. Bicoid subfamily.Contains 1 homeobox DNA-binding domain. |
| Gene Name | PITX1 paired-like homeodomain 1 [ Homo sapiens ] |
| Official Symbol | PITX1 |
| Synonyms | PITX1; paired-like homeodomain 1; BFT, paired like homeodomain transcription factor 1; pituitary homeobox 1; POTX; PTX1; |
| Gene ID | 5307 |
| mRNA Refseq | NM_002653 |
| Protein Refseq | NP_002644 |
| MIM | 602149 |
| Uniprot ID | P78337 |
| Chromosome Location | 5q31.1 |
| Function | protein binding transcription factor activity; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; |
| ◆ Recombinant Proteins | ||
| Pitx1-4863M | Recombinant Mouse Pitx1 protein | +Inquiry |
| Pitx1-4864M | Recombinant Mouse Pitx1 protein | +Inquiry |
| PITX1-12849M | Recombinant Mouse PITX1 Protein | +Inquiry |
| PITX1-372HF | Recombinant Full Length Human PITX1 Protein | +Inquiry |
| PITX1-29536TH | Recombinant Human PITX1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PITX1-1358HCL | Recombinant Human PITX1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PITX1 Products
Required fields are marked with *
My Review for All PITX1 Products
Required fields are marked with *
